KEGG   Listeria monocytogenes serotype 4b LL195: BN389_26710Help
Entry
BN389_26710       CDS       T02416                                 

Gene name
recR
Definition
(GenBank) Recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
lmog03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN389_26710 (recR)
DNA repair and recombination proteins [BR:lmog03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     BN389_26710 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BN389_26710 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5
Motif
Other DBs
NCBI-ProteinID: CCO65245
UniProt: A0A0E1RBA2
Position
complement(2728906..2729535)
Genome map
AA seq 209 aa AA seqDB search
MCILKVRGRRIMHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVD
AKRNLSFCSVCGHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHG
TISPMDGIGPEDINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKVTR
IAHGLPVGGDLEYADEVTLSKAMEGRREV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atttgtattttgaaggtgagaggaagacgaattatgcattatcctgagccgataacgaaa
ttaatagatagttttatgaaattaccaggaattggaccaaaatcggcagctcgactagct
ttttatgtgttagatatgaaagaagacgatgtgctagattttgcaaaagcccttgttgat
gcgaagcgaaacctaagcttttgttccgtttgtggtcacattacagataaggatccatgt
tatatttgcgctgatacgtcacgcgatcgaagtgttatctgtgtagtacaagaatccaaa
gatgtcattgcaatggaaaaaatgcgtgattttcatggcttataccatgtacttcatgga
acaatttcgccaatggatggaattggaccagaagatattaacattcctgatttgctgaaa
cgtttgcaagatgacacgattgaagaagttattttagcaaccaaccctaatgttgaagga
gaagccacggcgatgtatatttcgcgcttattaaaaccttcaggcataaaagtaactaga
atagcgcatggccttccagttggcggagacttggaatatgcggatgaagtgacgctctca
aaagcaatggaaggacgaagagaagtataa

DBGET integrated database retrieval system