KEGG   Listeria monocytogenes serotype 4b LL195: BN389_27100Help
Entry
BN389_27100       CDS       T02416                                 

Gene name
ycjM
Definition
Putative sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN389_27100 (ycjM)
Enzymes [BR:lmog01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BN389_27100 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2767512..2769194
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNARGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIITLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSSTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNPGEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELETDTYRQTIFTSLKKLVQIR
RNHTVFSPFATQEILDLGPDVFAIKRESEEECIYGIINVTSHNIRKTLAFSGTNLLTNQP
VTSELELTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagctgca
taccaacccgcatacttggaaaaaatgctcgcatgcgccgaaaactattctaataatgcg
cgtggttcgattgatactatttccgaaaaaaacgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaagcatccgttacaaacattgaatgaattcctacaagaatatgcg
caagatgttattacagatgtccacttgctgccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggtttaagcgattctccgataacgaagcgccgtacaatcaatttttcatcgag
aaggacagccaatttgattataaaaacgtcacacgtccgcggacttctccgctgttccac
aaatacgaaaacggtaaagaactttggactacttttagcgaagatcagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtactgcttttctatgcatccaaa
caagcgacaagcattcgacttgatgccattggatttttatggaaaacttctggcactact
tgtatgcacctgccagaaacccatgagatcatcacgctttggcgtctgctgattgatgaa
ctatatccaaatctgcaaattatcacagaaacaaacgtccctcatgaagaaaacattagt
tattttggcgatggtgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctagcacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggccaagtttcctataaagacaacgcagatggcacgcagtcggtatac
gaacttaatattaactacggtgaagccctgcaaaacccgggcgaagacacaaccgaagaa
ctcgtaacgaaaaaaattatcgctgctcatagtattttgctaacacttcaaggcgtccca
gcgatttactatcattcccttctaggttctaaaaacgaccttgttggttacgaagaatcc
ggtattaatcgccgcatcaatcgtgaaaaactggaaaaaaatcaattggttcatgaactt
gaaacagacacttatcgacaaaccattttcacatcactgaaaaaattggtgcaaatcaga
cgaaaccacaccgttttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgattaaacgggaatctgaggaagaatgtatttacggaattatcaacgtcact
tctcataatatccgcaaaacgctcgctttctctggcacgaatctattaaccaatcaaccc
gttacgagtgaacttgaattaactgcatatgaggttgtttggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system