KEGG   Listeria monocytogenes serotype 4b LL195: BN389_28220Help
Entry
BN389_28220       CDS       T02416                                 

Gene name
ycjM_2
Definition
Putative sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmog  Listeria monocytogenes serotype 4b LL195
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmog00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN389_28220 (ycjM_2)
Enzymes [BR:lmog01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BN389_28220 (ycjM_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2887522..2889225)
Genome map
AA seq 567 aa AA seqDB search
MMTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEE
SKKTLKTFKKMYDSYLKSTFEVVHFLPFYPYSSDDGFSVIDYKAVNPELGDWEDIKEMEQ
SARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQF
DSGKVGHIWTTFSEDQIDLNFASPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTS
SIHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPL
VLHAIHHGNAEFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNDL
EEEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRMSRFLVAHAVLMSIPGVPAV
YVQSILGSRNDYSGVETTGHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRK
AESLFHPEIPMEVLESTAELFVVKRSSDVESIILIHNLSEKEVSYSLDSGVYTNLYTGST
VTGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatagt
ttggcagctagaatcgaagcgcgggtacagcaaacgcaacaacgaaagttaacacgaaaa
gatcagtgggacgagaaagatattgttttaattacatatggagaccaatttaaagaggaa
tccaaaaaaacgttaaaaacttttaagaaaatgtatgatagttatttaaaatcgactttt
gaggtagttcatttcttgcctttttatccttattcttcggatgatgggttttcggtcatc
gattataaagcggtgaacccggaacttggtgattgggaagatattaaggagatggaacag
tcggcgcggttgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggttt
aagcgatatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaag
acggaccttagttcggtaacaaggccacgtgcgacaccagtgctgacaccatttcaattt
gattcaggaaaagtagggcatatttggacgacttttagtgaggatcaaatcgatttaaac
tttgcttctccggaagtgctttacaagatgattgatgttttgatgttctatttagaagaa
ggtgcggaatatgtgcgacttgatgcggttggctttatgtggaaagtgccgggaacgagc
tcgattcatttagaagagacgcatgaaatcgtgaaattatttagagatttagtagacatt
gcagctccggggacgattattataaccgaaaccaatgtgccgcatgttgataatattagt
tattttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccactt
gtgctccatgcgatacatcatggtaatgcagaattcctccgtaactgggcgaagaattta
gagctaccagaaggcaagcgaacattctttaatttccttgcctcacatgatgggattggg
ttaaatccagtgcgcggcattattccagaagctgaaattttggctttagtgaatgatttg
gaggaagaaggcgcgctcgtttcatataagcaaaatccagatggttctaagagtccgtat
gaaattaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgacttgagg
atgtcgagatttcttgtggctcatgcagtactaatgtctatcccaggcgttccagccgtt
tatgttcaaagtattttaggaagccgcaatgattattcaggcgtagaaacaacaggccac
aatcgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaa
agaggctccttacgaaaagcaacttatgatgcgttaacgaaattaattagcacacgaaaa
gcggaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattg
tttgttgttaaacgttcatccgacgtggaatcgattatattgattcataatttatcagaa
aaagaagtgagttattcactagacagcggtgtttatacaaatctttatacgggctccaca
gtaactgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaa
aattacagggaggaacaaaaatga

DBGET integrated database retrieval system