KEGG   Listeria monocytogenes J1-220: LM220_12117Help
Entry
LM220_12117       CDS       T02776                                 

Definition
5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lmoj  Listeria monocytogenes J1-220
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lmoj03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1388204..1389025)
Genome map
AA seq 273 aa AA seqDB search
MPEMPEVENVRATLQELVPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKF
LLFDLTNCTILSHLRMEGKFRLMDEKEEVSKHTHIIFHFEDHTELRFLDVRKFGTMEVTN
KYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEIC
FEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKV
YGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatgccggaagtagaaaatgtccgcgcaactttacaagaattagtcccaggt
aaaaaaatagatcaagtaattgttcgtgttccaaaaatgattgtatcaacaccacccgat
gagtttgtgcatatgcttgtcgggcaagaaatagagggtgtacgccgtcgtggtaaattc
ttactttttgacttaaccaactgtacgattttatcgcatttacgaatggaaggtaaattt
cggttaatggatgaaaaggaagaggttagcaagcatacgcatattatttttcattttgaa
gatcacacggaattgcgttttttagatgtgcgaaaatttggcacgatggaagtaacaaat
aaatacggtgagggtgaaacgcggtcgattaaaaagcttggcccagaaccgctgacgcaa
gcctttacattaacggattttgcgactggtgtaaaaaaaacaagccgcgccatcaaaacg
gctttacttgatcaaaagttagtagccggagtaggaaatatttatgcggatgaaatttgt
tttgaagcaaaagtgcgcccggaaagagcagctaactcactttcagacaaagaaatcaaa
cgtatttttgaagcgacgaaaagtattatgactgaagctgtagcacttggtggctccact
gtcagaacatatgtaaattcgcaagggaagcttggacaatatcaagataaattaaaagta
tacggcaaaacagacgaaccgtgtgttgtttgtggaacgccaattgaaaaaattaaatta
aacggacgcgggacacatttttgcccgaattgccaaaaatag

DBGET integrated database retrieval system