KEGG   Listeria monocytogenes J1-220: LM220_13282Help
Entry
LM220_13282       CDS       T02776                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmoj  Listeria monocytogenes J1-220
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmoj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM220_13282
Enzymes [BR:lmoj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LM220_13282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
694847..696226
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDKKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGEFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQAVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATNITKKNSSYEISFVDGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEMMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggcttgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacaaaaaactaggcggg
aaatttgaaacggttaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcctacatttaccaccaaaaagcacttcatccgattccagaa
ggctcagtgatgggaattccaacagataaagaagcattgctagctagtacactcgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacaa
gatcaagcacttggcgaattctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggagatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaagcagttaaaaaatatgggaatttgatggatggcttaaaa
gaaagtagcatgcaaacgacagggacaaaagctactattggtgcttttcgaacattagaa
ggcgggctagatgcgttaccaaaagccattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacgaacattacgaaaaagaatagctcttacgaaatttcttttgta
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgctaatt
catttattagcagaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagatggaacaggctat
ctagttgccagaaccgccccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccagaaaataaaatgttactacgaggctttgttgggaaagcgggagaa
acttggttagagcaagcaagtgatgaagcaatcgtttcagctgttttgagagattatgcg
gaaatgatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgca
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
gcagattacccaggggtttattttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggagctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system