KEGG   Listeria monocytogenes L312: LMOL312_0222Help
Entry
LMOL312_0222      CDS       T02247                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmol  Listeria monocytogenes L312
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMOL312_0222 (folP)
Enzymes [BR:lmol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LMOL312_0222 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229168..230103
Genome map
AA seq 311 aa AA seqDB search
MKIPNSLFDRCGLLPFPHRFFCALKSLNSAIINLGKRCLGLKKWKRDHLGMVMGILNVTP
DSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPGFSEVTPEEELNRIIPVIKAV
RTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIAEVAAKYNVPICLMHNRE
NTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEIVAL
GYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVLPIARMVRMTD
AITGKLDITKL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcccaaactccctttttgaccgatgcggtttactcccttttccgcatcggttt
ttttgtgcgctaaaatcactgaattctgctataataaatctcggaaagaggtgtttgggc
ttgaagaagtggaaaagggatcacttaggtatggtcatggggatactgaatgttacgcca
gactctttttcggatggcgggaaatatatgcaagtggaagaagctgtggctcgagcgtta
caaatggcagaagatggagcagcaattattgacgttggtggaatatctactcggcctggt
ttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtcattaaagctgtt
aggacaaaacttccggatatatggatttctgttgatacttggcgtgccgaagtggctgaa
aaagctattttagcaggagctaatatgataaatgatcaatggggtgccaaaaaagaaccg
aaaattgctgaagtagctgcgaaatataacgtgccaatttgtttgatgcacaaccgagaa
aacacgcaatacgataattttctggaagatgtgaagaaagacttattagaaagtgttgca
attgctaaagcggcatccgtgccagatgaacatattattcttgatccgggtttcggtttt
gttaagacgcctgcgcagaatttagaagtgttacgacgcattgatgagatagtggcgctt
ggttacgaggttttacttggtacgagtagaaagtcgacaattggtctcgtcttaggaact
actccagaggatagaatggaaggaactggggcgacaaccgtttacggattttcgaaaggt
tgcacaattactcgtgtacacgatgtacttccaattgcgcgcatggtaagaatgacagac
gcgattacgggcaaattagatattacaaaattataa

DBGET integrated database retrieval system