KEGG   Listeria monocytogenes L312: LMOL312_0270Help
Entry
LMOL312_0270      CDS       T02247                                 

Gene name
dapE
Definition
succinyldiaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmol  Listeria monocytogenes L312
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmol01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmol00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294492..295631
Genome map
AA seq 379 aa AA seqDB search
MERQRKIQILKDIVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
DEKVLAFSGHMDVVDAGDVSKWKFPPFEAAEHEGKIYGRGATDMKSGLAAMIIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKAQLKGNIRSIPEMDNETVKQVLVKIINKLNKQENMNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgacaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgaa
tccgaaaaggtacaatacgacgtagacagagccagcctagttagcgaaattggttccagt
gacgagaaagttttggcgttttcagggcatatggatgtcgttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcagcagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaagtcaggtctagcggcgatgattattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagtggacaccggattgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcgcatagttcgatgccggaattcggtgttaatgcgatt
gacaacttgttgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcaccgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgcaactaaaagggaatattcgctcgattccagaaatggat
aacgaaacagtgaaacaagtgctagtgaagattatcaataagttaaataaacaggaaaat
atgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccatta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system