KEGG   Listeria monocytogenes L312: LMOL312_0344Help
Entry
LMOL312_0344      CDS       T02247                                 

Gene name
tpiA-1
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00010  Glycolysis / Gluconeogenesis
lmol00051  Fructose and mannose metabolism
lmol00562  Inositol phosphate metabolism
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
lmol01120  Microbial metabolism in diverse environments
lmol01130  Biosynthesis of antibiotics
lmol01200  Carbon metabolism
lmol01230  Biosynthesis of amino acids
Module
lmol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmol_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOL312_0344 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOL312_0344 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOL312_0344 (tpiA-1)
Enzymes [BR:lmol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOL312_0344 (tpiA-1)
Exosome [BR:lmol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOL312_0344 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOL312_0344 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOL312_0344 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY66422
Position
complement(375165..375929)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSMGTLETTANLLAGTLF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttaaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacattattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgacttaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcgaagaagattaaacttgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccgtgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaagcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggagtgggcaattggaaaggcgtcttcagctgag
acaaactacatcgaaagcgcgcatcaagcgctgcgtgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system