KEGG   Listeria monocytogenes L312: LMOL312_0582Help
Entry
LMOL312_0582      CDS       T02247                                 

Definition
glycosyl hydrolase, family 1 (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmol  Listeria monocytogenes L312
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOL312_0582
Enzymes [BR:lmol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOL312_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614750..616144
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRFFNDVGPTNTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
YPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIILNLTPSYPRSQNPADLKAA
HIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWLHKAIEEGSNCHGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELSENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagagaatttttggtggggaagtgcggcgtccggcccacaaaca
gaaggcgcagcaaatgtagatggcagaaaaccgagtatttgggatcactggtacaaaatc
gaaccaggtcgtttctttaacgatgtaggacctacgaatacatctaatttttactatcaa
tataaagaagatattgctttaatgaaacaaactgggcataattctttccgtacttcgatt
cagtggtcacgtcttattccagatggtattggcgaagtgaatccgaaagcggttgatttt
tacaatcgcgttattgatgaaatgcttgcaaatgacgtggaaccatttatgaatttatat
cattttgatatgccaatgtcgatgcaagaaaaaggcggttttgaaagccgtgaagtagtt
gacgcgtatgcaacttttgcgaaaacatgttttgaattattcggagatcgtgtgaaacat
tggtttacttttaatgaaccaattgttcctgttgaagcaggttacttatacgatatgcac
tatccgaatgtcgttgattttaaacgtgcgactcaggttgcttaccatactactttggca
catgcgcttgctgttaaagaattccacgcacttgaaattccagaaggccaaattggaatc
attttaaacttaacaccgtcgtatccaagaagccaaaatccggcagatttaaaagcggct
catattgcagatctaattttcaaccgtagtttccttgatccggttacaaaaggggaattc
ccagctgaccttgttgaaattattcgcgaacatgacgcgcttccagaatatactgaagaa
gatttggcgataattaaaaacaacattattgatattcttggtgtaaactactaccaaccg
cgtcgtgtgaaagcgaaagaatacgcagctcatccggatgcaccatttatgccagaacat
ctttttgataactatgaaatgccttaccgcaaaatgaatccatatcgtggttgggaaatt
ttcgaaagagcaatttatgatattgcgattaatctgcgtgataactacgataatattcca
ttcttcatttctgaaaatggtatgggtgtagaaggcgaaagtcgctaccgtaatgcagac
ggaatgattgaagatacgtaccgaatcgatttcattaagagtcacttgaaatggctgcat
aaagccattgaagaaggttctaactgtcatggttatcatctttggacattcatggattgc
tggagctgggcgaatgcttacaaaaaccgttatggcttagtagaagttgatttagacaat
aatttcaaacgtactataaaagcatccggacattggtacaaagaactttcagaaaacaat
ggttttgaagactaa

DBGET integrated database retrieval system