KEGG   Listeria monocytogenes L312: LMOL312_1079Help
Entry
LMOL312_1079      CDS       T02247                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmol  Listeria monocytogenes L312
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOL312_1079 (galU)
   00052 Galactose metabolism
    LMOL312_1079 (galU)
   00500 Starch and sucrose metabolism
    LMOL312_1079 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOL312_1079 (galU)
Enzymes [BR:lmol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMOL312_1079 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1113750..1114637)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDILIVTGKGK
RAIEDHFDSVPELENNLREKNKLELLHLVEQTTNINLHFIRQAKPKGLGDAILQAKGFVG
NEPFIVMLGDDIVESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDPINEYDKN
LYNVKGFVEKPDPANAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEVQ
RVFAYDFEGQRFDVGDKFGFIQTTMQFALKHPEIKDDVKDLINDLYNQIHKKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagctgtaattccagctgctggtctaggcacgcgctttttaccagca
acaaaagcaatgcctaaagaaatcttaccaattgtggataaaccaactattcaatacata
gtagaagaagcagtagcatctggcatagaagatattttaattgtaaccggtaaaggtaaa
cgtgctatcgaagaccattttgattccgttcctgaacttgaaaacaatctacgggaaaaa
aataaacttgaattactacatttagtagaacaaactactaacattaatttgcactttatt
cgtcaagcgaaaccaaaaggacttggtgatgccatccttcaagcaaaaggctttgtgggt
aatgaaccatttatcgttatgttaggtgatgatattgttgaatccaaaatcccttgttcc
aaacaattaatgaatcaatatgaaaagacgcatagttccgtcattggagtccaaactgtc
cctcacgaagagacatatcgttatggtattattgatccaattaatgaatatgataagaat
ttatataatgtgaaaggttttgtggaaaaaccagatcctgctaatgcaccgtctgattta
gctatccttggccgttacttattaacaccacaaattttcgacttcttagaaacgcaaaaa
ccaggtgcaggaggcgaaattcaactaaccgatgcaatcaatagtctaaatgaagtacaa
cgtgtatttgcttatgactttgaaggacagcgttttgatgttggcgataaattcggcttt
atccaaacaacaatgcaattcgctttgaagcatcctgaaatcaaagatgatgtgaaagat
ctgattaacgacttatataaccaaattcataaaaaagataaaaaataa

DBGET integrated database retrieval system