KEGG   Listeria monocytogenes L312: LMOL312_1188Help
Entry
LMOL312_1188      CDS       T02247                                 

Gene name
cobA
Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmol  Listeria monocytogenes L312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmol00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205808..1207277
Genome map
AA seq 489 aa AA seqDB search
MLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLHHPIT
QEEIEQILVKEAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAIGGLA
YAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICANLLEN
GRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQLNFFE
EMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVVDVVPTKTKEELSEVSELLF
TSKEAVERFFDYLAQLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTELILE
HLPRLQKNVSNLIIGSIVDTAEVTAILAEVEAMEMMPLYDMRPVTERPFDLASFEQVCFS
SSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINNFIEAESATPESLIELIQ
KTKLEGVPQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttaattggtgcaggtcctggagatgcacagctgctaaccgtgaaaggtttagctgca
ctgcaaaaggcagatgttattgtatacgatcgcctcgttgaaccagcgatgctccaagaa
cgaaaagctagttgtaaactcatttatgtcggaaaagaaccacttcatcatccaattacc
caagaggaaatcgagcaaattcttgttaaagaagctgcgacaaatgagctggttgttcgt
ctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaaggagagacactctat
aaagcgggaattccatttgaagttattcctggaatcacatccgcgattggtgggcttgcc
tacgctggaatcccagtaacacatcgtgattttgcttcgagttttcacgtgattaccgga
catttgaaaaaaggacgcgatccactagattgggaagcccttgctagactggaaggtacg
ctcgttttcctgatgggaatgactaatttgcctaatatttgtgcgaacttactagaaaat
ggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgcggcaaacaatta
acggttaccgggaacttacaaaacatcgaacaaaaagtagcggaatctggtatttcttcg
ccggcacttattgtcgttggtgatgtggtgagcttacgaccgcagcttaacttctttgag
gaaatgccacttttccatacaaaagtattacttccaagagcacgagctggaaaaagtatg
ctcgcggaacaaattcgcgatttaggcggagaagtaacaatgtatcccaatattcaagta
gtagatgttgtgccaacgaaaacaaaagaagaactaagcgaagtaagcgaacttcttttc
acatccaaagaagcggtagaacgattttttgattatttagcccagcttgatttagatatt
cgttctctaaaaaatacccatcttaccgctattggcaaacaaacaaaagaagcttttagt
gaaaaaggaattattccagatagtttcattaaaaggcggagcacggaattaattttggag
catttaccacggttacagaaaaatgtgagcaacttaattatcggaagcatagttgatacg
gcagaagttaccgcaattttagcagaagtggaagcgatggaaatgatgccgttatatgat
atgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaagtttgtttctca
agttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaaaaagccatttta
caaacgaaaacaattctttccattggaaggttcacgagcgcaacgttagcatcattcggt
atcaacaattttatcgaagccgaaagcgccacaccagagagcttaattgaactaatccaa
aaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system