KEGG   Listeria monocytogenes L312: LMOL312_1412Help
Entry
LMOL312_1412      CDS       T02247                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00071  Fatty acid degradation
lmol00072  Synthesis and degradation of ketone bodies
lmol00280  Valine, leucine and isoleucine degradation
lmol00310  Lysine degradation
lmol00362  Benzoate degradation
lmol00380  Tryptophan metabolism
lmol00620  Pyruvate metabolism
lmol00630  Glyoxylate and dicarboxylate metabolism
lmol00640  Propanoate metabolism
lmol00650  Butanoate metabolism
lmol00900  Terpenoid backbone biosynthesis
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
lmol01120  Microbial metabolism in diverse environments
lmol01130  Biosynthesis of antibiotics
lmol01200  Carbon metabolism
lmol01212  Fatty acid metabolism
lmol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOL312_1412
   00630 Glyoxylate and dicarboxylate metabolism
    LMOL312_1412
   00640 Propanoate metabolism
    LMOL312_1412
   00650 Butanoate metabolism
    LMOL312_1412
  Lipid metabolism
   00071 Fatty acid degradation
    LMOL312_1412
   00072 Synthesis and degradation of ketone bodies
    LMOL312_1412
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOL312_1412
   00310 Lysine degradation
    LMOL312_1412
   00380 Tryptophan metabolism
    LMOL312_1412
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOL312_1412
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOL312_1412
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LMOL312_1412
Enzymes [BR:lmol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOL312_1412
Exosome [BR:lmol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOL312_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBY67490
Position
complement(1427382..1428551)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system