KEGG   Listeria monocytogenes L312: LMOL312_1531Help
Entry
LMOL312_1531      CDS       T02247                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmol  Listeria monocytogenes L312
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMOL312_1531 (ruvA)
Enzymes [BR:lmol01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LMOL312_1531 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1551933..1552538)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
SKEEDLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgtcgag
gcaggacaaatcggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggtacagaagcacaagtctttttgtatcaacatgtgcgggaggataatatttctctattc
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcgctagctattattgcttcaggcgatgtcgttccactgatttctgct
attgaatccgaagacgatgtttatttaaccaaatttccaagcgttggtaaaaaaacagca
cgccaaatcattcttgatttgaaaggcaaactagctgatgttgtcgcgagcgaaattgtt
tatgttgctccagaaaacgatatggttgctggactttctccgcaattagaagaagctgta
ttagctttagaagcgctcggttatagcacgcgagaactaaaaaaagtaataccaaaattg
tcaaaagaagaagacctaacaagcgacgcatatatcaagctagcactacaattaatgaca
aaatag

DBGET integrated database retrieval system