KEGG   Listeria monocytogenes L312: LMOL312_1554Help
Entry
LMOL312_1554      CDS       T02247                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lmol  Listeria monocytogenes L312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmol00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1573990..1574964)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVASMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAMSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVLEMLT
SMKRAGATLIITYFAKDASKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagcttctatgcctggggtttttcaatatcctttacatgaa
ctagaagaagaaatgcgcgtagttgagagccttggtattaaagcggttattttatttggt
attcctgccgagaaagacgcagttggcacgcaagcttatcacgaccacggaattattcaa
gaagctacaaggcttataaaaaaaagttttcctgaaattcttgtggtggctgacacatgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggggaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgctgcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagcgggattttatgatatcccaattatgtcatatgcagttaaatatgcgtctgctttt
tatggaccgttccgtgatgctgctggtagtgcccctcaatttggtgatagaaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaatgtcggatgaacaagaa
ggtgcagatttccttattgttaaaccatcattatcatacttagatatcatgcgcgatgtt
aagaacaataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagatgaagaaaaaattgttttagaaatgctaaca
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgcatccaaa
tatttaaataaatag

DBGET integrated database retrieval system