KEGG   Listeria monocytogenes L312: LMOL312_1555Help
Entry
LMOL312_1555      CDS       T02247                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmol  Listeria monocytogenes L312
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOL312_1555 (hemD)
Enzymes [BR:lmol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMOL312_1555 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1574961..1575683)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREANKNKPWQTYFSQNGFEVTSIPLIKTRPIKMDLSREQQQTDWLFLTSANA
VEYFFTNQHERFNYKIAVIGEKTKEKLAEFGHEPNFVPSIYQSEVFLEEWLNENPEKTSI
LIPQSNLSRTIIKDRLIEKGYIVVSFELYETIFPENSKIRLIEQLKLNETQIIVFASPSA
WKNFYSTAKSFPAQKEKWHIASIGSITTEAIIADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgaataaaaacaaaccatggcaaacctat
ttttcgcaaaatggttttgaagtgacgtcaatcccgctgattaaaacacgacctataaaa
atggatttgagtcgagaacaacaacaaacagactggctttttttaacaagtgcaaatgct
gtagaatatttctttacgaaccaacatgaaagattcaattataaaatagctgtcatcggt
gaaaaaacaaaagaaaaactggcagaatttggtcacgaaccaaattttgtcccatctatc
tatcagtcagaagtatttttagaagaatggctaaacgaaaacccagagaaaacaagtatc
ttaataccacaaagtaatttaagcagaacaataataaaagatagattgattgaaaaaggt
tacatcgttgtttcgtttgagctctatgaaacaatctttccagaaaattctaaaatacgg
ttaatcgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccactgcgaagtcattccctgctcaaaaagagaagtggcatatt
gcatccattggtagtattacaacagaagccattatagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system