KEGG   Listeria monocytogenes L312: LMOL312_1629Help
Entry
LMOL312_1629      CDS       T02247                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00260  Glycine, serine and threonine metabolism
lmol00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
lmol01130  Biosynthesis of antibiotics
lmol01230  Biosynthesis of amino acids
Module
lmol_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOL312_1629 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOL312_1629 (trpA)
Enzymes [BR:lmol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOL312_1629 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBY67707
Position
complement(1653562..1654335)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAKKDHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLARSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQTLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDNHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcgaaaaaagatcatgctgccgtagttacttac
attatgggtggcgatggtggcttagataatttagaagaacagttattgtttctcgaaaaa
tctggtgtaagcgcgattgaaattggtattcctttttctgatccggttgccgacggtccg
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctaggagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtatcccgaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattcctgatttaccttatgagcaccaaacactgattacgccagaacttcaaggg
acagatatcgcacttattccgcttgtttcattgacaagtccgaaagagcgcctcgaagaa
attgcgaaacaggcagaagggtttatttatgcagtaacagttaacggaactaccggtgtg
aggagtgaatttgatgcccatattgataaccatttagcttatttaaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtggaaaaatttgcgcat
gtatgtgatggtgtaataatcggtagtaaagtcgtgcaaatgttacatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggccgcagaagttcgaatcgaaaactaa

DBGET integrated database retrieval system