KEGG   Listeria monocytogenes L312: LMOL312_1630Help
Entry
LMOL312_1630      CDS       T02247                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmol  Listeria monocytogenes L312
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOL312_1630 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOL312_1630 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOL312_1630 (trpB)
Enzymes [BR:lmol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOL312_1630 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1654328..1655530)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQIND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagacgaggcgtaccgggcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaataatactattgggcaagcctta
ctcgcacgtcaaatgggtaaacaaaaagtagtggcagaaactggcgcaggacaacacggg
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtgtttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagacacgcattacattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgtgataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgttgcttgtgttggaggcgggagtaat
gcgatggggttattttatccatttgtagatgatgtttctgttcaaatgcacggtgtggaa
gcagcgggacacggtttagaaactgaattccatgcagcgactatttccaaaggagaaata
gggattttacacggagcgatgatggacgttttacaagatgagaatggacaaattttggaa
gcattttcgatttcagctggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtaccattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacggaaggaatcattcctgcactcgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccaaatgcgtccagaagaaagtatggtcgtttgtttatct
ggtcgcggagataaagatgttaatcaactaaaggaacgcttggagggacaaataaatgac
taa

DBGET integrated database retrieval system