KEGG   Listeria monocytogenes L312: LMOL312_1670Help
Entry
LMOL312_1670      CDS       T02247                                 

Gene name
asnB
Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00250  Alanine, aspartate and glutamate metabolism
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOL312_1670 (asnB)
Enzymes [BR:lmol01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LMOL312_1670 (asnB)
Peptidases [BR:lmol01002]
 Cysteine Peptidases
  Family C44
   LMOL312_1670 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: CBY67748
Position
complement(1699435..1701300)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPSVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLGLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaacagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgtgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtgggatgtttggtttcgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccatttggcattaaaccatttttctatgcagaagaagatggcaaattgttcatg
ggttctgaaaagaaatccattctacatgctttaaaagaaaaagaattggatgaagtttca
ttacaaaactatatgacttaccaattcgttccagaaccagattccttaactaaaaatgta
aaacgtttagaaccaggacatcagttcacgaagaaaattggtcaaccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtgatgtatgattctgtaaaaatgcatatgcgctctgatgtaccagttggt
tcattcctatctggtggtattgattcatcgattattgctgcgattgctaaagaatatcat
cctgcaatcaaaacattctctgttggttttgaacgcgatggtttcagtgaaatcgatgtc
gcaaaagaaacagcagacaaacttggcgtagaaaacattagttatgttatctcacctgaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgatccacttgctgatcca
gctgctattccgctttacttcttatcaagagaagcgcgcaaacaagtaacggttgcattg
tccggtgaaggtgcagatgaacttttcggtggttataacatttataacgaaccgaattcc
cttgcgatgtttaacaaaatgccaagcgtatttaaatcaatgctaaatagcgtggcgcgc
attatgccagaaggtatgcgtggtaaaagtttcttagaacgtggaaccactccgatggaa
gaacgctatatcggaaacgccaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaatatcaagctggtcatgactatacgaacattacagatccattttatgcagaaacaacg
aattatcatcctgtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctcaaagctgaccgcatgacgatggctaattcgctggaagtccgtgtacctttc
cttgataaagaagtgtacaatgtggcaagaaatattccagatacaatgaaaacaaccaat
ggaacaaccaaatatatcttacgtaaagcggcagcaacatttgtaccagaacacgtactt
aaccgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaacatcattaaagaatcaccaacagatcatttaattaacaaacaatac
gttctaggattactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtatgatgtatacgtagcagataaatacgattttgga
aaataa

DBGET integrated database retrieval system