KEGG   Listeria monocytogenes L312: LMOL312_2108Help
Entry
LMOL312_2108      CDS       T02247                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lmol  Listeria monocytogenes L312
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LMOL312_2108
Enzymes [BR:lmol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LMOL312_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2173628..2174278)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNSEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLEFAPATSPELAEIVRKHVIELGDKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcaaaaatagtgaagacgatgtttgaccgc
tttgaaacgaatgcagctggaggaaatgtaagtgtgcgcatgaatagtgagcacattatt
atgacacctacactcatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtcgtagaaggagacggaagagttactagagaaattaac
ttacaccgcgcttgttacgtagaaaatccaaaaattggttgtgtactccatgctcatcca
aaagaatcgatgctatttgccacacttggaatggaattaccgaatttaacagaagcaacg
caaaaaattggccaaattccaacacttgaatttgcgccagcgactagtccagaacttgcg
gaaatcgttcgtaaacacgttatcgaactaggagataaagctgttcctagtgcaagttta
ttaaataaacacggtattgtcgtattagatacatcacttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctatattgcagaaaaagcgttagtatttgatgcgttaggt
ataaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

DBGET integrated database retrieval system