KEGG   Listeria monocytogenes L312: LMOL312_2410Help
Entry
LMOL312_2410      CDS       T02247                                 

Gene name
est-1
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lmol  Listeria monocytogenes L312
Brite
Enzymes [BR:lmol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LMOL312_2410 (est-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2495511..2496257)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENDYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTPEQIDAEMVAYKDAPMNTIAKLKDEINGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacgattatacttgctatgcgcctcaatacagaggccacggtgtatctcctgacctactg
ttaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggttacacggaaatcgctgtagcgggactttcgctaggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagttcatcaccaataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacacctgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aacacaatcgctaaactaaaggacgagataaatggcgtcgtggctgaaatagatatgatt
tatgcgccaataatggtcgtccaaggtgaaaaagacgatatggttgatgtgagcggagca
cagctaatttatgatacagtagagtcaacgaagaaagaattgcactggtttaaagaatct
gggcacgtcatcacattagacaaagaacgaaaagaagtaaatcaagccattttaacattt
ttagatagtttagattggcaagaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system