KEGG   Listeria monocytogenes L312: LMOL312_2511Help
Entry
LMOL312_2511      CDS       T02247                                 

Gene name
murA-2
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00520  Amino sugar and nucleotide sugar metabolism
lmol00550  Peptidoglycan biosynthesis
lmol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMOL312_2511 (murA-2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMOL312_2511 (murA-2)
Enzymes [BR:lmol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LMOL312_2511 (murA-2)
Peptidoglycan biosynthesis and degradation proteins [BR:lmol01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   LMOL312_2511 (murA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: CBY68589
Position
complement(2599716..2600987)
Genome map
AA seq 423 aa AA seqDB search
MTDKLIIRGGKKLAGTLQVDGAKNSAVALIPAAILAESEVVLEGLPDISDVHTLYNILEE
LGGTVRYDNKTAVIDPTDMISMPLPSGNVKKLRASYYLMGAMLGRFKKAVIGLPGGCYLG
PRPIDQHIKGFEALGAKVTNEQGAIYLRADELKGARIYLDVVSVGATINIMLAAVRAKGK
TVIENAAKEPEIIDVATLLTNMGAIIKGAGTDTIRITGVEHLHGCHHTIIPDRIEAGTFM
VLAAASGKGVRIENVIPTHLEGIIAKLTEMGVPMDIEEDAIFVGEVEKIKKVDIKTYAYP
GFPTDLQQPLTALLTRAEGSSVITDTIYPSRFKHIAEIERMGGKFKLEGRSAVINGPVQL
QGSKVTATDLRAGAALVIAALLADGETEIHGVEHIERGYSKIIEKLSAIGANITRSSAAE
TKL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacggataaattgattattcgaggcggtaaaaaattagctggtactttgcaagtggat
ggcgcaaaaaatagtgcggtggcattaattccagcggcaattttggcggagtctgaagtg
gttttagaaggtttaccagatatttcggatgttcacacactttataatattttagaagag
cttggcggcacggttcgctatgataataaaacagcagttattgatccaacagatatgatt
tctatgccacttccatcgggaaatgtgaagaaattacgtgcgtcctattatttaatgggt
gcaatgttaggccgatttaaaaaagcggttattggacttccaggcggttgttacttaggg
ccacgtccaatcgaccaacatataaaaggttttgaagcattaggcgcaaaagtaacgaac
gagcaaggtgcgatttatttgcgtgccgatgaactcaaaggtgcacggatttatttagat
gttgtaagtgttggagcgacaatcaatatcatgctagcggctgttcgtgcaaaaggaaaa
acggttatcgaaaatgcagcaaaagagccagaaattattgatgttgcaacgcttttaaca
aatatgggagcaattattaaaggtgcaggaactgatactattcgaatcactggggtagag
catttacatggttgtcatcatacaattattccagaccgaatcgaagcagggacattcatg
gtacttgcagcagcttctgggaagggagtacgaatcgaaaatgttattcctacccattta
gaaggaatcattgcaaagctcacagaaatgggcgttccaatggatatcgaagaagatgct
atttttgttggggaagtagaaaaaataaaaaaagtagatattaaaacttacgcttatcca
ggcttcccaacggacttacaacaaccgttaactgctcttttaacacgtgcggaaggtagt
agtgtcatcactgatacaatttatccaagccgttttaaacacattgcggagattgaacga
atgggcggtaagtttaaacttgaaggtcgttcggctgtcataaatggtcctgtgcaactt
caaggttctaaagtgacagcgacagatttacgcgccggtgcagcgcttgtaattgcagca
cttttagctgacggagaaactgaaattcacggggtggaacatatcgaacgtggttacagt
aagattattgaaaaattatctgctattggcgcaaatattactcgtagtagcgcagcagaa
acaaaattataa

DBGET integrated database retrieval system