KEGG   Listeria monocytogenes L312: LMOL312_2687Help
Entry
LMOL312_2687      CDS       T02247                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmol  Listeria monocytogenes L312
Pathway
lmol00010  Glycolysis / Gluconeogenesis
lmol00620  Pyruvate metabolism
lmol00640  Propanoate metabolism
lmol00680  Methane metabolism
lmol01100  Metabolic pathways
lmol01110  Biosynthesis of secondary metabolites
lmol01120  Microbial metabolism in diverse environments
lmol01130  Biosynthesis of antibiotics
lmol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOL312_2687 (acsA)
   00620 Pyruvate metabolism
    LMOL312_2687 (acsA)
   00640 Propanoate metabolism
    LMOL312_2687 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LMOL312_2687 (acsA)
Enzymes [BR:lmol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMOL312_2687 (acsA)
Lipid biosynthesis proteins [BR:lmol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMOL312_2687 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBY68765
Position
2765070..2766647
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDAEGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccaccatgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgaccattggctcgatattcacgaagacgatatcgtttgggccacagctggtcct
ggttggcaaaaatgggtttggtctcctttcctttctgtactcggaaaaggtgccactggc
ttcatttacaacggtcgtttcattcctgaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctgtgctgtacgccaacagaatatcgcttaatggctaaagtaaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccaagataattttgatattaaagttcgcgacggctacggtcaa
acggagagtacactgttgattgggacactggttgatacgccgattcgccctggttcgatg
ggtaaaccgattatgccagaatacatggcaattattgacgctgaaggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
attagctctggttacacgattggaccgttcgaagtagaggacgcgctcacacatcatcca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggtacggtcgtaaaa
gcatttatcgtcttaaaggatggttacgagggcacggaagatcttgtgcatgaattacaa
acattcacgaaagaacaaaccgctccgtataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system