KEGG   Listeria monocytogenes L312: LMOL312_2702Help
Entry
LMOL312_2702      CDS       T02247                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmol  Listeria monocytogenes L312
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmol00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2779757..2781439
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNARGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIITLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSSTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNPGEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELETDTYRQTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEEECIYGIINVTSHNIRKTLAFSGTNLLTNQP
VTSELDLTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagctgca
taccaacccgcatacttggaaaaaatgctcgcatgcgccgaaaactattctaataatgcg
cgtggttcgattgatactatttccgaaaaaaacgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaagcatccgttacaaacattgaatgaattcctacaagaatatgcg
caagatgttattacagatgtccacttgctgccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggtttaagcgattctccgataacgaagcgccgtacaatcaatttttcatcgag
aaggacagccaatttgattataaaaacgtcacacgtccgcggacttctccgctgttccac
aaatacgaaaacggtaaagaactttggactacttttagcgaagatcagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtactgcttttctatgcatccaaa
caagcgacaagcattcgacttgatgccattggatttttatggaaaacttctggcactact
tgtatgcacctgccagaaacccatgagatcatcacgctttggcgtctgctgattgatgaa
ctatatccaaatctgcaaattatcacagaaacaaacgtccctcatgaagaaaacattagt
tattttggcgatggtgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctagcacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggccaagtttcctataaagacaacgcagatggcacgcagtcggtatac
gaacttaatattaactacggtgaagccctgcaaaacccgggcgaagacacaactgaagaa
ctcgtaacgaaaaaaattatcgctgctcatagtattttgctaacacttcaaggcgtccca
gcgatttactatcattcccttctaggttctaaaaacgaccttgttggttacgaagaatcc
ggtattaatcgccgcatcaatcgtgaaaaactggaaaaaaatcaattggttcatgaactt
gaaacagacacttatcgccaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaatcacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgataaaacgggaatctgaggaagaatgtatttacggaattatcaacgtcact
tctcataatatccgcaaaacgctcgctttctctggcacgaatctattaaccaatcaaccc
gttacgagtgaacttgatttaactgcgtatgaagttgtctggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system