KEGG   Listeria monocytogenes L312: LMOL312_2805Help
Entry
LMOL312_2805      CDS       T02247                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmol  Listeria monocytogenes L312
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmol00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMOL312_2805
Enzymes [BR:lmol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMOL312_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2895210..2896910)
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
KKTLKTFKKMYDSYLKSTFEVVHFLPFYPYSSDDGFSVIDYKAVNPELGDWEDIKEMEQS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPKTDLSSVTRPRATPVLTPFQFD
SGKVGHIWTTFSEDQIDLNFASPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAEFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRMSRFLVAHAVLMSIPGVPAVY
VQSILGSRNDYSGVETTGHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDVESIILIHNLSEKEVSYSLDSGVYTNLYTGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcgtttatatgccgaagatgtggtagatagtttg
gcagctagaatcgaagcgcgggtacagcaaacgcaacaacgaaagttaacacgaaaagat
cagtgggacgagaaagatattgttttaattacatatggggaccaatttaaagaggaatcc
aaaaaaacgttaaaaacttttaagaaaatgtatgatagttatttaaaatcgacttttgag
gtagttcatttcttgcctttttatccttattcttcggatgatgggttttcggtcatcgat
tataaagcggtgaacccggaacttggtgattgggaagatattaaggagatggaacagtcg
gcgcggttgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgctatttggcgggtgacgaggagtttaggaacttttttgtggaaatggatccaaagacg
gaccttagttcggtaacaaggccacgtgcgacaccagtgctgacaccatttcaatttgat
tcaggaaaagtagggcatatttggacgacttttagtgaggatcaaatcgatttaaacttt
gcttctccggaagtgctttacaagatgattgatgttttgatgttctatttagaagaaggt
gcggaatatgtgcgacttgatgcggttggctttatgtggaaagtgccgggaacgagctcg
attcatttagaagagacgcatgaaatcgtgaaattatttagagatttagtagacattgca
gctccggggacgattattataaccgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgcgatacatcatggtaatgcagaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcgaacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcggcattattccagaagctgaaattttggctttagtgaatgatttggag
gaagaaggcgcgctcgtttcatataagcaaaatccagatggttctaagagtccgtatgaa
attaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgacttgaggatg
tcgagatttcttgtggctcatgcagtactaatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattattcaggcgtagaaacaacaggccacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgttaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgtggaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttatacgggctccacagta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

DBGET integrated database retrieval system