KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_0244Help
Entry
LMOSLCC2376_0244  CDS       T02222                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmon00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(284179..285615)
Genome map
AA seq 478 aa AA seqDB search
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDH
YHRYKEDVKLMAEAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFYDNLIDELLKYDIEPLV
TLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYG
QALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNV
QAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLASAKPDFMGVNY
YQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGL
QIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcaaaaacgttcaccattcccgaaagatttcttatggggttctgcatcggca
gcttatcaaatcgaaggcgcatgggacgcagacggcaaaggcaaatcagtttgggacgaa
tatgtccgcattcctggaactacttttaaaggtacaaatggcgatgtagctgttgaccat
tatcaccgttataaagaagacgtaaaattaatggcagaggctggcctaaaagcttaccgt
ttctctatcgcttggactcgtatcttcccaaatggtaaaggcgaagtgaatgaagctgga
ttgaaattttatgataacttaattgatgagttgcttaaatatgacattgaaccgcttgta
accctttatcactgggatatcccacaagcattatttgatgaatacggtggctgggaatct
cgccaagttattgaagatttcacgaattattccacaacgctattcaaacgttacggcgac
cgtgtgaaatattgggtttccttgaatgagcaaaatatctttgttggtatgggttatggt
caagcgcttcacccaccaaaagttagcgatccaaaaagaatgtacgcagtcaaccacatt
gcgaacttagctaatgcgagtgttatcaaagctttccacgaaatcgttcctgatggaaaa
attggaccaagttttgcttacacaccacattatccaatcgacacagatcctaaaaatgtt
caagctgccgacgatgcagaagaattaaacagttatttctggatggatatgtatgctttt
gggcgctatccgaaagcggtttggaaatatttagaagaaaacgatattgcgccagttatt
gaagacggcgatatggaacttcttgcttctgcaaaaccagatttcatgggcgtgaactac
tatcaatccgcaactgttgcttacaacccgcttgatggcgttggtcaaaacaacgaaatg
aacttcactggtaaaaaaggcagcacaaaagaaactggtgttcctggcgtttacaaaaaa
gtcgttaatccttttgtaaaaacaacgaactgggactggacaatcgatcctaaaggctta
caaattgcgcttcgtcgtattaacagccgctatgctttaccaattttaattacggaaaat
ggtttaggtgaatttgataaattagttgatggcgaagtaaacgatgactaccgtattgac
tatctaagcgcgcacgcaaccgctattcgcgatgcaatcagtgatggtgttgatatgtta
ggctattgtacttggagcttcacagaccttctaagctggttaaacggctatcaaaaacgt
tacggttttgtttatgttgaccgcgacgtggaagatgatgcgccaatgacgcgtattccg
aagaaaagttattactggtataaacaagtgattgaaactaatggagcagatttataa

DBGET integrated database retrieval system