KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1049Help
Entry
LMOSLCC2376_1049  CDS       T02222                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOSLCC2376_1049 (galU)
   00052 Galactose metabolism
    LMOSLCC2376_1049 (galU)
   00500 Starch and sucrose metabolism
    LMOSLCC2376_1049 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOSLCC2376_1049 (galU)
Enzymes [BR:lmon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMOSLCC2376_1049 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1078939..1079826)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELELNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDEYSKN
LYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVALLVDELYAEIHLKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagcagtcattccagcagcaggattagggacgagatttctgcctgcc
acaaaagcaatgcctaaagaaattcttccaatagtagacaagccaaccattcaatacata
gtagaagaagcagtagaatctggaattgaagatattctaattgttactggtaaagggaaa
agagctattgaagatcactttgactctgtaccagaacttgagctcaatctacgtgaaaaa
aacaaactagaattacttcatttaattgaagaaacaacaaatattaatctacattttatt
cgtcaatcgaaacctaaaggacttggtgatgccatcttacaagcaagaggttttgttggt
aacgaaccatttatcgttatgttgggcgatgacattgtacaagcaaaaacaccatgtgca
aaacaactaatagatcaatatgaaaaaacacatagttcaatcattggagttcaaacggtt
cctcatgaagaaacttatcgttacggcattatcgatccaattgatgaatatagtaaaaat
ctgtacaatgtaaatggttttgtcgaaaagcctgatccaagtgcggcaccatctgacctt
gctattctgggtagatatctactaacacctcagatttttgactttctagaaacacaaaaa
cctggtgctggtggggaaattcaactaaccgacgctatcaacagtttaaatgagattcag
cgtgtgttcgcttatgacttcgaaggagaacgttttgatgttggcgataaatttggtttc
attaagacgaccatgcaatttgctttaaaacatccggaaattaaagacgatgttgctctc
ttagtagatgaattatatgctgaaattcacttgaaggataaaaaataa

DBGET integrated database retrieval system