KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1293Help
Entry
LMOSLCC2376_1293  CDS       T02222                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:lmon01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmon00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lmon00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmon00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmon00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lmon00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314445..1315413
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAISNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataaaggt
gcccacattgttaaaaatattggcgactctatcaatcaaaaattaacagatttacaacta
gataatgatattttttacggtattggaatgggaaccccagggactgttaattatgaaact
ggtacagtcaaaggtgcttataacctaggttgggctgaagaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgctgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattggccatgtaacagtagttccggaaaacggttatgactgtacttgtggt
aaaaagggctgtttagaaactgtcgcatcagctacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatacaggtaaatctgcgcttaaagatgcaataagcaacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaacc
attgataaaatttctttctatttggcattagcgcttagtcacattggtaatatgttaaat
ccagagaaaattattatcggcggtggagtttcagcggctggcgaccaactattaacacca
gtaaaaacttattttgagacaatggttttcccggcggttaaagaatctactaaattatct
attgcgacaaaagggaatgacgcagggataatcggagccgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system