KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1528Help
Entry
LMOSLCC2376_1528  CDS       T02222                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
lmon00010  Glycolysis / Gluconeogenesis
lmon00030  Pentose phosphate pathway
lmon00051  Fructose and mannose metabolism
lmon00052  Galactose metabolism
lmon00680  Methane metabolism
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
lmon01120  Microbial metabolism in diverse environments
lmon01130  Biosynthesis of antibiotics
lmon01200  Carbon metabolism
lmon01230  Biosynthesis of amino acids
lmon03018  RNA degradation
Module
lmon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2376_1528 (pfk)
   00030 Pentose phosphate pathway
    LMOSLCC2376_1528 (pfk)
   00051 Fructose and mannose metabolism
    LMOSLCC2376_1528 (pfk)
   00052 Galactose metabolism
    LMOSLCC2376_1528 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2376_1528 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMOSLCC2376_1528 (pfk)
Enzymes [BR:lmon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMOSLCC2376_1528 (pfk)
Protein phosphatases and associated proteins [BR:lmon01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMOSLCC2376_1528 (pfk)
Messenger RNA biogenesis [BR:lmon03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LMOSLCC2376_1528 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBY63560
Position
complement(1556998..1557957)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatc
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactattggttttgat
actgcattaaacactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgtgatgctggtgatatcgctctttggtct
ggacttgctggtggcgctgaagctatcatcgttccagaagaaagctttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtcgtt
gctgagggcgtaatgtctggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcgcgttcagtagaattattgttagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatctattttgtcgatttaa

DBGET integrated database retrieval system