KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1586Help
Entry
LMOSLCC2376_1586  CDS       T02222                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOSLCC2376_1586 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2376_1586 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2376_1586 (trpB)
Enzymes [BR:lmon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOSLCC2376_1586 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1616136..1617338)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLENEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQVLE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagacgaggcgtaccgagcatccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggtcgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcgcataaaatcaataatactattgggcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggcgcgggacaacacggg
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtaagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagatacacattatattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgttattggaatagaagccagaaaacagcat
ttggaaaacgaaggcaaacttcctgatgcaattgtcgcttgtgtaggtggtggcagcaat
gcgatgggcttgttttatccattcgtagacgatgtttctgttcaaatgcacggggtagaa
gcagcggggcacggtttagaaactgaattccatgcagcaactatttccaaaggagaaatc
gggattttacacggagcgatgatggatgttttacaagatgagaatgggcaagttttagaa
gcattttcgatttcagcaggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtatcattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacagaaggaatcattcctgcactcgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccagatgcgtccagaagaaagtatggtcgtttgtttatct
ggtcgcggagataaagatgttaaccaactaaaagaacgcttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system