KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1586Help
Entry
LMOSLCC2376_1586  CDS       T02222                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
lmon00260  Glycine, serine and threonine metabolism
lmon00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmon01100  Metabolic pathways
lmon01110  Biosynthesis of secondary metabolites
lmon01130  Biosynthesis of antibiotics
lmon01230  Biosynthesis of amino acids
Module
lmon_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2376_1586 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2376_1586 (trpB)
Enzymes [BR:lmon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOSLCC2376_1586 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBY63618
Position
complement(1616136..1617338)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLENEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQVLE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagacgaggcgtaccgagcatccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggtcgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcgcataaaatcaataatactattgggcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggcgcgggacaacacggg
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtaagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagatacacattatattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgttattggaatagaagccagaaaacagcat
ttggaaaacgaaggcaaacttcctgatgcaattgtcgcttgtgtaggtggtggcagcaat
gcgatgggcttgttttatccattcgtagacgatgtttctgttcaaatgcacggggtagaa
gcagcggggcacggtttagaaactgaattccatgcagcaactatttccaaaggagaaatc
gggattttacacggagcgatgatggatgttttacaagatgagaatgggcaagttttagaa
gcattttcgatttcagcaggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtatcattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacagaaggaatcattcctgcactcgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccagatgcgtccagaagaaagtatggtcgtttgtttatct
ggtcgcggagataaagatgttaaccaactaaaagaacgcttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system