KEGG   Listeria monocytogenes SLCC2376: LMOSLCC2376_1623Help
Entry
LMOSLCC2376_1623  CDS       T02222                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmon  Listeria monocytogenes SLCC2376
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmon00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2376_1623 (asnB)
Enzymes [BR:lmon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LMOSLCC2376_1623 (asnB)
Peptidases [BR:lmon01002]
 Cysteine Peptidases
  Family C44
   LMOSLCC2376_1623 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1660273..1662138)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaatagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtggaatgtttggtttcgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccatttggcattaaaccatttttctatgcagaagaagacggcaaattgttcatg
ggttctgaaaagaaatccattttacatgctttaaaagaaaaagaattagatgaagtttca
ttacaaaactatatgacttatcaattcgttccagaaccagattccttaactaaaaatgta
aaacgtttagaaccaggacatcagttcacgaagaaaattggtcagccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtgatgtacgattctgtaaaaatgcatatgcgctccgatgtaccagttggt
tcattcctatctggtggtattgattcatcgattattgctgcgattgctaaagaataccat
ccagcaatcaaaacattctctgttggttttgaacgtgatggtttcagtgaaatcgatgtc
gcaaaagaaacagcagacaaacttggtgtagaaaacattagttatgttatttcaccggaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgatccacttgctgatccg
gctgctattccgctttacttcttatcaagagaagcgcgcaaacaagtaacagttgcattg
tccggtgagggggcagatgaacttttcggtggttataacatttataacgaaccaaattcc
cttgcgatgtttaacaaaatgccaggcgtatttaaatcaatgttaaatagcgtggcgcgt
attatgccagaaggtatgcgtggtaaaagtttcttagaacgtggaactactccgatggaa
gaacgctatatcggaaacgcgaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaataccaagctggacatgattatacgaacattacagatccattttatgcggaaacaacg
aattatcatcctgtagaaagaatgcagtatattgatattcatacgtggcttcgtggcgat
attctcttaaaagctgaccgcatgacaatggctaattcactggaagtccgtgtacctttc
cttgataaagaagtgtacaacgtggcaagaaatattccagatacaatgaaaacaaccaac
ggaactactaaatatatcttacgtaaagctgcagcaacatttgtaccagaacatgtactt
aatcgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gtgctagacttactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtacgatgtatacgtagcagacaaatacgactttgga
aaataa

DBGET integrated database retrieval system