KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_0021Help
Entry
LMOSLCC2378_0021  CDS       T02240                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmoo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23735..25168
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPAKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVAEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaagactttttatggggcggagcagttgctgccaaccaa
tgtgaaggagcttatcttgaagacggtaaaggactttcacttgttgatatccttccaaca
gtagaggacggacgttgggaagctttattcaatccagcgaaagcgcttgctacagattat
ggtttttacccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggcagaaatgggattcaaatgtttccgtatgtccatcagttggccacgtattttc
ccgaatggtgatgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcacaaatatggtattgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggtggttggaaaaatcgtaaatgcatcgacttttacttg
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaattaacatgattcttcatcttccatacattggtggaggtttagacgttactaaa
gaggacaatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatcagca
cttgcaactaaacttggtcatgaaatcaatcctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacatatccaatgacttgtaatccaaaagatgtctggaagtctatcgaggcg
gaccgtgaaggctacttcttcattgatgttcaagcacgcggatactacccaagctacact
aagcgtttcttcaaagaacacaacatcaacatcaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattacgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggttggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttatcaaaaacctcttttcatcgttgaaaatggcttaggtgca
gtggatactgtggcagaagacggctcaatcactgatgattacagaatcgactacatgcgt
gaacacgttcgcgaaatgggcgaagcaattgaggatggcgtggaacttcttggttataca
ccatggggctgcatcgaccttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctacgttgaccgcgataataaaggtaacggaaccctaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactaa

DBGET integrated database retrieval system