KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_0237Help
Entry
LMOSLCC2378_0237  CDS       T02240                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmoo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238350..239285
Genome map
AA seq 311 aa AA seqDB search
MKIPNSLFDRCGLLPFPHRFFCALKSLNSAIINLGKRCLGLKKWKRDHLGMVMGILNVTP
DSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPGFSEVTPEEELNRIIPVIKAV
RTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIAEVAAKYNVPICLMHNRE
NTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEIVAL
GYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVLPIARMVRMTD
AITGKLDITKL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcccaaactccctttttgaccgatgcggtttactcccttttccgcatcggttt
ttttgtgcgctaaaatcactgaattctgctataataaatctcggaaagaggtgtttgggc
ttgaagaagtggaaaagggatcacttaggtatggtcatggggatactgaatgttacgcca
gactctttttcggatggcgggaaatatatgcaagtggaagaagctgtggctcgagcgtta
caaatggcagaagatggagcagcaattattgacgttggtggaatatctactcggcctggt
ttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtcattaaagctgtt
aggacaaaacttccggatatatggatttctgttgatacttggcgtgccgaagtggctgaa
aaagctattttagcaggagctaatatgataaatgatcaatggggtgccaaaaaagaaccg
aaaattgcggaagtagctgcgaaatataacgtgccaatttgtttgatgcacaaccgagaa
aacacgcaatacgataattttctggaagatgtgaagaaagacttattagaaagtgttgca
attgctaaagcggcatccgtgccagatgaacatattattcttgatccgggtttcggtttt
gttaagacacctgcgcagaatttagaagtgttacgacgcattgatgagatagtggcgctt
ggttacgaggttttacttggtacgagtagaaagtcgacaattggtctcgtcttaggaact
actccagaggatagaatggaaggaactggagcaactacagtttacggattttcgaaaggt
tgcacaattactcgtgtacacgatgtacttcccattgcgcgcatggtacgaatgacagat
gcgattactggcaaattagatattacaaaattataa

DBGET integrated database retrieval system