KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_1052Help
Entry
LMOSLCC2378_1052  CDS       T02240                                 

Gene name
glpK-1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lmoo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064202..1065665
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKAGELVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIV
DILAKHDLIPADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKELCETLKKAGYE
KRIKQLTGLKIDSYFSASKMKWLLENSSAVRDAASRNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDAFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGSPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMTGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPAEELSAIGAIEIADNKLQNKRTIAKLYQPNITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatcgctattgatcaaagcacatctggaacgaaagtattattg
tttaaagcaggtgaacttgtagatcgtttagataaaaagcatcgacagttgtatccgaag
aaaggctgggtagagcataatccaatcgaaatttgtcaaaatgtccgtacattaattgtg
gacatattggcaaaacatgatttaattccagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacgggcaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaactttgcgaaacattaaaaaaagctggttatgaa
aaaagaattaaacagcttaccggattgaaaattgattcttatttttctgcttctaaaatg
aagtggttattggaaaatagttctgcggtgcgggatgcagcaagtcgtaatcaattggca
tttggtacaatggatgcttggttgttattttcgcttacggatgatagtaattatttcaca
gaccgaacaaacgccagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaactttttggagttaaacgtgcttatttaccagaagtgaagcaatctgct
ggaagttttggaagttatcaggagataccgattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatgcatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaaggaattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggttcgccttattggaatacagatatacgagcagagattcttggtctcaca
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgacaggtcaaaatattaagcgcttacaagta
gacggtggattaacaaagcaacatgagttgatgcaatatttagcagatgttttaaaagca
gaagtggcagtcagtcccgcggaagaactttcggcaattggtgctattgaaattgccgac
aataaactacaaaataagagaacgatagcaaaattgtaccaaccaaatatcactcataca
catgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system