KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_1525Help
Entry
LMOSLCC2378_1525  CDS       T02240                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
lmoo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMOSLCC2378_1525 (recD)
Enzymes [BR:lmoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LMOSLCC2378_1525 (recD)
DNA repair and recombination proteins [BR:lmoo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LMOSLCC2378_1525 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_16 AAA_12 AAA_22 NTPase_1 UvrD-helicase T2SSE AAA_17 UvrD_C AAA_18 AAA AAA_28 Zeta_toxin TsaE ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: CBY73292
Position
complement(1520686..1523082)
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFNDTPEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLINYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDIKGIGFQRADELGRKLGLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQNILVAQVEKLAEEQKIITENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQ
EIFNPNDTGRRKEVQFGDIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMAG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgctctatttaacgatacaccagaagaacttttcatgaag
ggcacgatgttgtccaccattttttacaatgccgaaaacctcttttctgttgtacgaata
ttggtcaaagaaaccaatgcggattgggacgaaaaagatattatcgtaaccggttttttc
ccagcgcttcacgagcaagaagtatacactttctacgggaaaatgcaggaacatgctaaa
tttggtcaacagtttaaagcagaccggtttcgtaaggaaatgccacaatcacgagcgggc
ttaattaattatctatccggtgaactttttaaaggcattggtaaagtcactgctgaaaat
attgtggatacgattggcgacgatgctatcacaaaaattttatccgatccgagcttgcta
aatacagtacctaagttgccatctggcgcggcagaaagtttgcttgcttcccttagagaa
aatcaagggttggagcatgtgatggtcggattaaacgaatatggctttggtccgcaatta
tccatgaaaattttccaggcctataaacaaaatgcgattgaagtgttagagaataatcct
tataaattgattgaggatataaaagggattggttttcagcgtgccgatgagcttggacgg
aaactcggtcttggcgggaatcatccagaacggcttcgtgctgggattttatttatgtta
gattcggtttgtatgcaacaaggtcatgtatatatggagcaagaggttctgctcggagaa
gtaacttatttactggaagaaagcgaaggcattcgtattgaccaaaatattttagtagct
caagtagaaaaattagctgaggaacaaaagattattacggaaaatacacgtgtttacatg
ccatcactctattattcagagagcggctttgcatatcacgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccgcaatccgaatttctgctagctctaggagaattagaa
gaacggattggcgttcactacggagattcgcagcgacaggctttagaacaagctttaatg
tctccgatgctcgtacttactggtggtcccgggacagggaaaacaacagtcattaaaggg
atagtggagctttatgcggaactaaatggtgtgagccttgatccccatgcttacaaagat
ggagcgactttccccgttcttcttgctgctccaactggccgtgccgctaaacggatgtct
gagtcaacagggcttcctgcgatgaccattcaccgtttacttggaatgaatggtcaagaa
caaatggatgatgatgcagaaagactgattgatggacgactgttgatagtggatgagatg
tcaatggtagatatttggcttgctaatcaattattccgtgctttaccagcgcacatgcaa
gtggtacttgttggcgaccaagatcagttgccttcagtcggaccaggtcaagtactcaaa
gatattctgcaatctgaacaaattccaactgtagctctttcagatatttaccgccaaaag
gatggttcttccattatcgaaatggcgcattatataaaagaaggcatgttgccagctgat
ttcaccaaaaatagcgccgatcgctccttttttcattgcacggtaaatcaaattggtgat
gtagtcgaacaagtggtaaaaaatgcaaaaaacaaaggatttcgagcaaaagacatccaa
gttttagcaccaatgtatcgtggtcctgcaggcattgatattttaaataaaaaactacaa
gaaattttcaatccaaatgatacagggcgtcgtaaagaagttcaatttggtgacataaag
tatcgcgtgcatgacaaagtactgcaattgattaatcaaccagagaaaaatgtgtttaac
ggtgatattggtgaaattgtgtctattatatacgccaaagaaaataccgaaaaacaagat
ctgattgtcgttcaatttgaccaaacagaggtttcttactataggcaagaatttaatcaa
ttgacccatgcttattgttgttcgatccataaagcgcagggaagtgaatttccgattgtg
attatgccgattgtccgcagttactaccggatgttacggcgcgatttattatacaccgga
gtaacgcgaagtaaacaatttctcattctttgcggggaagaagaagcttttcgaatgggg
atagaacgaattgatgaaaataaacgtaatacaacactctctgaacgtttaatgagcgaa
gatgttttattagaacaaatgacaaataaacgaattctcacagctgaaaatattacggaa
attgatccgatgattggaatggaagggattactccagaacaatttatggcaggataa

DBGET integrated database retrieval system