KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_1573Help
Entry
LMOSLCC2378_1573  CDS       T02240                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
lmoo00860  Porphyrin and chlorophyll metabolism
lmoo01100  Metabolic pathways
lmoo01110  Biosynthesis of secondary metabolites
lmoo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC2378_1573 (hemD)
Enzymes [BR:lmoo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMOSLCC2378_1573 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF3916 GP11
Motif
Other DBs
NCBI-ProteinID: CBY73340
Position
complement(1572159..1572881)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREANKNKPWQTYFSQNGFEVTSIPLIKTRPIKMDLSREQQQTDWLFLTSANA
VEYFFTIQHERFNYKIAVIGEKTKEKLAEFGHEPNFVPSIYQSEVFLEEWLNENPEKTSI
LIPQSNLSRTIIKDRLIEKGYIVVSFELYETIFPENSKIRLIEQLKLNETQIIVFASPSA
WKNFYSTAKSFPAQKEKWHIASIGSITTEAIIADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgaataaaaacaaaccatggcaaacctat
ttttcgcaaaatggttttgaagtgacgtcaatcccgctgattaaaacacgacctataaaa
atggatttgagtcgagaacaacaacaaacagactggctttttttaacaagtgcaaatgct
gtagaatatttctttacgatccaacatgaaagattcaattataaaatagctgtcatcggt
gaaaaaacaaaagaaaaactggcagaatttggtcacgaaccaaattttgtcccatctatc
tatcagtcagaagtatttttagaagaatggctaaacgaaaacccagagaaaacaagtatc
ttaataccacaaagtaatttaagcagaacaataataaaagatagattgattgaaaaaggt
tacatcgttgtttcgtttgagctctatgaaacaatctttccagaaaattctaaaatacgg
ttaatcgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccactgcgaagtcattccctgctcaaaaagagaagtggcatatt
gcatccattggtagtattacaacagaagccattatagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system