KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_1645Help
Entry
LMOSLCC2378_1645  CDS       T02240                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
lmoo00260  Glycine, serine and threonine metabolism
lmoo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmoo01100  Metabolic pathways
lmoo01110  Biosynthesis of secondary metabolites
lmoo01130  Biosynthesis of antibiotics
lmoo01230  Biosynthesis of amino acids
Module
lmoo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2378_1645 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2378_1645 (trpA)
Enzymes [BR:lmoo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOSLCC2378_1645 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBY73412
Position
complement(1649284..1650057)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAKKDHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLARSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQTLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDNHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcgaaaaaagatcatgctgccgtagttacttac
attatgggtggcgatggtggcttagataatttagaagaacagttattgtttctcgaaaaa
tctggtgtaagcgcgattgaaattggtattcctttttctgatccggttgccgacggtccg
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctaggagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtatcccgaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattcctgatttaccttatgagcaccaaacactgattacgccagaacttcaaggg
acagatatcgcacttattccgcttgtttcattgacaagtccgaaagagcgcctcgaagaa
attgcgaaacaggcagaagggtttatttatgcagtaacagttaacggaactaccggtgtg
aggagtgaatttgatgcccatattgataaccatttagcttatttaaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtggaaaaatttgcgcat
gtatgtgatggtgtaataatcggtagtaaagtcgtgcaaatgttacatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggccgcagaagttcgaatcgaaaactaa

DBGET integrated database retrieval system