KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_1648Help
Entry
LMOSLCC2378_1648  CDS       T02240                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
lmoo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmoo01100  Metabolic pathways
lmoo01110  Biosynthesis of secondary metabolites
lmoo01130  Biosynthesis of antibiotics
lmoo01230  Biosynthesis of amino acids
Module
lmoo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2378_1648 (trpC)
Enzymes [BR:lmoo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LMOSLCC2378_1648 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CBY73415
Position
complement(1651860..1652618)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKAVEVADMPLEKVAEKRKTYSFYEFLKANTSTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVEIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEMLIALFEQALALDLEVLVEVHDQKELAVAQKIGAKLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYNAVLVGEALMREAT
PEAAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagcagtagaagttgcagacatgccctta
gaaaaagtagccgaaaaacggaaaacttattcgttttatgaatttttaaaagcaaatacc
agcacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccggttctgcaagccaagtcttatcaagctgcgggtgcgggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtcgaaattcctgtactttgtaaagattttattattagtgaaaaacaattgatt
cgtgctcgaaatgcgggagcaacggttgtattgctaattatttcggcacttacagaagag
atgctaattgctctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccagaaagaattagctgttgctcaaaaaattggagctaaactcattggtgtgaac
aaccgtaatttgcatacatttgaagtggatattgcagtaagtgaaagactggcgagcgat
ttctcgtcggatgcttgtttcataagtgaatcaggttttcgaacagctgaagatgtggct
cgggttagtcaaaaatataatgcagtacttgttggagaagcgctaatgcgagaagcgact
ccagaagcagcggcgaaaagtttgaaggtgacacgatga

DBGET integrated database retrieval system