KEGG   Listeria monocytogenes SLCC2378: LMOSLCC2378_2120Help
Entry
LMOSLCC2378_2120  CDS       T02240                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lmoo  Listeria monocytogenes SLCC2378
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmoo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LMOSLCC2378_2120
Enzymes [BR:lmoo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LMOSLCC2378_2120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2163377..2164027)
Genome map
AA seq 216 aa AA seqDB search
MLYQKEREDLAKIVKTMFDRFETNAAGGNVSVRMNNEHIIMTPTLMSQAKLCDLSPYEIL
VVDNNNEVVEGDGRVTREINLHRACYVENPKIGCVLHAHPKESMLFATLGMELPNLTEAT
QKIGQIPTLEFAPATSPELAEIVRKHVIELGDKAVPSASLLNKHGIVVLDTSLHKAYDML
ERIEYNAYIAEKALVFDALGIKKLAHDRELNYNLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttataccaaaaagaacgtgaagatttagcaaaaatagtgaagacgatgtttgaccgc
tttgaaacgaatgcagctggaggaaatgtaagtgtgcgcatgaataatgagcacattatt
atgacacctacactcatgagtcaagcaaaactttgcgatctttccccatatgaaatcctt
gtagtggataataacaatgaagtcgtagaaggcgatgggagagttactagagaaattaac
ttacaccgcgcttgttacgtagaaaatccaaaaattggctgtgtactccatgctcatcca
aaagaatcgatgctatttgccacacttggaatggaattaccgaatttaacagaagcaacg
caaaaaattggccaaattccaacacttgaatttgcgccagcgactagtccagaacttgcg
gaaatcgttcgtaaacacgttatcgaactaggagataaagctgttcctagtgcaagttta
ttaaataaacacggtattgtcgtattagatacatcacttcataaagcatacgacatgcta
gagcgtattgaatacaatgcctatattgcagaaaaagcgttagtatttgatgcgttaggt
ataaaaaaattagctcatgaccgcgaattaaattataatttggaggagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system