KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_0257Help
Entry
LMOSLCC7179_0257  CDS       T02224                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmos01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmos00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283749..284888
Genome map
AA seq 379 aa AA seqDB search
MDQQKKIQILKDMVNIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
NEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEYGVNAIDNLILFYNEIEKYVASIHATNEILGDFIHNVTVINGGNQV
NSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHVKLELLFDYDKQPVFSDRNS
SLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKQFPVIIFGPGNETPHQVNENVSI
GNYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaaaaaaagattcaaattttaaaggacatggtaaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtacaatacgacgtagacagagctagcctagtaagcgaaattggttccagt
aacgagaaggttttggcattttcagggcatatggatgtagttgatgcgggtgatgtatct
aagtggaagttcccaccttttgaagcgacagagcatgaagggaaactatacggacgcggc
gcaacggatatgaagtcaggtctagcggcgatggttattgcaatgattgaacttcatgaa
gaaaaacaaaaactaaacggcaagatcagattattagcaacagttggggaagaaatcggt
gaacttggagcagaacaactaacacaaaaaggttacgcagatgatttagatggtttaatc
atcggcgaaccgagtggacacagaatcgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccagagtatggtgtgaatgcaatt
gataatttgatactattttataatgaaatagaaaaatacgttgcttccatccatgccaca
aatgaaatacttggcgattttattcataatgtcacggtgattaatggcggaaatcaagtc
aatagtattccggaaaaagcagaactacaaggtaatattcgttccataccagaagttgat
aacgagactttgaagcgacgtattgttgaaattgtgaatgagttaaataaaaaagaacat
gtgaagttagagttactgttcgattatgataaacagcctgtatttagcgataggaattca
agcttagtgaatgtcgcacgtgatgttgcgaaaggtattattaaagaagagataccctta
cttggaatttctggaacaacagatgcagctgaatttaccaaagcgaagaaacaattccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
ggaaattatttggagatggtagatgtttacaaacggattgccaccgagtttttatcttga

DBGET integrated database retrieval system