KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_0263Help
Entry
LMOSLCC7179_0263  CDS       T02224                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmos00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(289741..291177)
Genome map
AA seq 478 aa AA seqDB search
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDH
YHRYKEDVKLMAEAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFYDNLIDELLKYDIEPLV
TLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYG
QALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNV
QAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLASAKPDFMGVNY
YQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGL
QIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcaaaaacgttcaccattcccgaaagatttcttatggggttctgcatccgca
gcttatcaaatcgaaggcgcatgggacgcagacggcaaaggtaaatcagtttgggacgaa
tatgtccgcattcctggaactactttcaaaggtacaaatggcgatgtagctgttgaccat
tatcaccgttataaagaagacgtaaaactaatggcagaggctggcctaaaagcttaccgt
ttctctatcgcttggactcgtatcttcccaaatggtaaaggcgaagtgaatgaagctgga
ttgaaattttatgataacttaattgatgagttgcttaaatatgacattgaaccgcttgta
accctttatcactgggatatcccacaagcattatttgatgaatacggtggctgggaatct
cgccaagttattgaagatttcacaaattattccacaacgctattcaaacgttacggcgac
cgcgttaaatattgggtgtccttgaacgagcaaaatatctttgttggtatgggttatggt
caagcgcttcacccaccaaaagttagcgatccaaaaagaatgtacgcagtaaaccacatt
gcgaacttagctaatgctagtgttatcaaagctttccacgaaatcgttcctgatgggaaa
attggaccaagttttgcttacacaccacattatccaatcgacacagatcctaaaaacgtt
caagctgcggatgatgcagaagaattaaatagttatttctggatggatatgtatgctttt
ggtcgttatccgaaagctgtttggaaatatttagaagaaaacgatattgcgccagttatt
gaagatggcgatatggaactacttgcgtctgcaaaaccagatttcatgggcgtgaactac
tatcaatccgcaactgttgcttacaacccgcttgatggcgttggtcaaaacaacgaaatg
aacttcactggtaaaaaaggcagcacaaaagaaactggtgtccctggcgtttacaaaaaa
gtcgttaatccttttgtaaaaacaacgaactgggactggacaatcgatcctaaaggctta
caaattgcgcttcgtcgtattaacagccgctatgctttaccaattttaattacggaaaat
ggtttaggcgaatttgataaattagtagatggcgaagtaaatgatgactaccgtattgac
tacctgagcgcgcacgcaactgctatccgcgatgcaatcagtgacggggttgatatgtta
ggatattgtacttggagcttcacagaccttctaagctggttaaacggctatcaaaaacgt
tacggttttgtttatgttgaccgcgacgtggaagatgatgcgccaatgacgcgtattccg
aagaaaagttattattggtataaacaagtgattgagactaatggagcagacttataa

DBGET integrated database retrieval system