KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_0806Help
Entry
LMOSLCC7179_0806  CDS       T02224                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lmos01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmos00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lmos00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lmos00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:lmos00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821494..823440)
Genome map
AA seq 648 aa AA seqDB search
MKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNGSGVVK
RKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELCQYVAS
KYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISALSLLI
QQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVCAANVI
RISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEITQIARM
HKAISIIQFKLEGEIINRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFPTINPE
NPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPLHEDGT
FMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSLFGKSE
MTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPVKEGKG
ESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIKNETDI
LSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttacgcttgttagcaaaagaatatcctactatcgccaagacagctacggaa
atcattaacctcgaagcaattatgaaccttccaaaaggaacggaacattttttaagtgat
gttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggttctggtgttgtaaaa
cggaaaattcgtgatatttttggcgcagagctagatgatgcagagattaattcacttagt
acactgatttattatccagaagaaaagatggatttgattgctagtgaaacagaagatttg
catgcttggtatcgcaccacactttttcgtttgattgaactctgccagtatgttgcttca
aaatacacacgttctaaagttagaaaagccatgccagaagattttgcctacatattagaa
gagttacttcatgaaaactacaatgaagacgataaaaagctttattatgaagaaatttta
caacatattatttcacttggtcgtgcagaagaatttattagcgctctctcgctacttatt
caacaattggtcgtggatcatttgcacattgttggtgatgtttatgatcgtggcccttat
ccagataaaatcatggatacattaatgaattaccattcgctcgatttccagtggggtaat
cacgatattttatggatgggcgcggctagtggctctagggtttgtgcggctaatgttatt
cggatttctgctcgctatttaaatttagatattttagaagatagttacggtatttccctt
cgccccctagccctttttgccgacgaagtgtacaaagacgatccttgtacctacttccag
ccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacgcaaattgctaggatg
cacaaggctatctcgattattcagtttaaattggaaggtgaaattattaaccgacgcaaa
gaatttgatatgaatcatcggcttttacttcaatttatcgattacaaaaaaggcacaatt
caactaaaaggaaaagaataccagttgttagacaatcattttccaacgattaatccagaa
aatccttatgaacttactgatgcggagagagaacttattgggaaaattactgccgctttt
aaaaactgccgccgattgcaaaaacatgtacaatttctatattcaaaaggcagcatgttt
ttaacttataatggcaatttactctaccatggctgcattccgctccacgaagatgggact
tttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcgcttttagagcagttt
gaaatacttacccgcgaagcatacgtccgcccaactggaacaaaagaaaagaaatatgcg
tgtgatatcgtttggtatttgtggactggtgccatttcttcgctattcggaaaaagtgaa
atgactacgtttgaacgttattttgttgcagaaaaagaaacccacacagaggaaaaaaat
ccttattataaattgcgtaataacgaattaatttgcaaacaaattttagaagaatttgag
cttgacggagaatgcgggcatatcattaacggccatacgccagtcaaagaaggaaaaggt
gaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggcgggttcgcaaaagca
tatcataaagagacaaacttagcgggttatacactacttttcaacagttacggtttacaa
ctagttagtcatcagccatttactacaaaagaggatgctatcaaaaatgaaacggatatt
ctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgtgtaagggataccgat
attggggctaaacttagtgaacaggcagaagatttaaaattgctactagatgcttatcgt
aatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system