KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_0806Help
Entry
LMOSLCC7179_0806  CDS       T02224                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
lmos00010  Glycolysis / Gluconeogenesis
lmos00030  Pentose phosphate pathway
lmos00051  Fructose and mannose metabolism
lmos00680  Methane metabolism
lmos01100  Metabolic pathways
lmos01110  Biosynthesis of secondary metabolites
lmos01120  Microbial metabolism in diverse environments
lmos01130  Biosynthesis of antibiotics
lmos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC7179_0806 (fbp)
   00030 Pentose phosphate pathway
    LMOSLCC7179_0806 (fbp)
   00051 Fructose and mannose metabolism
    LMOSLCC7179_0806 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC7179_0806 (fbp)
Enzymes [BR:lmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMOSLCC7179_0806 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: CBY60012
Position
complement(821494..823440)
Genome map
AA seq 648 aa AA seqDB search
MKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNGSGVVK
RKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELCQYVAS
KYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISALSLLI
QQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVCAANVI
RISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEITQIARM
HKAISIIQFKLEGEIINRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFPTINPE
NPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPLHEDGT
FMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSLFGKSE
MTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPVKEGKG
ESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIKNETDI
LSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttacgcttgttagcaaaagaatatcctactatcgccaagacagctacggaa
atcattaacctcgaagcaattatgaaccttccaaaaggaacggaacattttttaagtgat
gttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggttctggtgttgtaaaa
cggaaaattcgtgatatttttggcgcagagctagatgatgcagagattaattcacttagt
acactgatttattatccagaagaaaagatggatttgattgctagtgaaacagaagatttg
catgcttggtatcgcaccacactttttcgtttgattgaactctgccagtatgttgcttca
aaatacacacgttctaaagttagaaaagccatgccagaagattttgcctacatattagaa
gagttacttcatgaaaactacaatgaagacgataaaaagctttattatgaagaaatttta
caacatattatttcacttggtcgtgcagaagaatttattagcgctctctcgctacttatt
caacaattggtcgtggatcatttgcacattgttggtgatgtttatgatcgtggcccttat
ccagataaaatcatggatacattaatgaattaccattcgctcgatttccagtggggtaat
cacgatattttatggatgggcgcggctagtggctctagggtttgtgcggctaatgttatt
cggatttctgctcgctatttaaatttagatattttagaagatagttacggtatttccctt
cgccccctagccctttttgccgacgaagtgtacaaagacgatccttgtacctacttccag
ccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacgcaaattgctaggatg
cacaaggctatctcgattattcagtttaaattggaaggtgaaattattaaccgacgcaaa
gaatttgatatgaatcatcggcttttacttcaatttatcgattacaaaaaaggcacaatt
caactaaaaggaaaagaataccagttgttagacaatcattttccaacgattaatccagaa
aatccttatgaacttactgatgcggagagagaacttattgggaaaattactgccgctttt
aaaaactgccgccgattgcaaaaacatgtacaatttctatattcaaaaggcagcatgttt
ttaacttataatggcaatttactctaccatggctgcattccgctccacgaagatgggact
tttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcgcttttagagcagttt
gaaatacttacccgcgaagcatacgtccgcccaactggaacaaaagaaaagaaatatgcg
tgtgatatcgtttggtatttgtggactggtgccatttcttcgctattcggaaaaagtgaa
atgactacgtttgaacgttattttgttgcagaaaaagaaacccacacagaggaaaaaaat
ccttattataaattgcgtaataacgaattaatttgcaaacaaattttagaagaatttgag
cttgacggagaatgcgggcatatcattaacggccatacgccagtcaaagaaggaaaaggt
gaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggcgggttcgcaaaagca
tatcataaagagacaaacttagcgggttatacactacttttcaacagttacggtttacaa
ctagttagtcatcagccatttactacaaaagaggatgctatcaaaaatgaaacggatatt
ctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgtgtaagggataccgat
attggggctaaacttagtgaacaggcagaagatttaaaattgctactagatgcttatcgt
aatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system