KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_1015Help
Entry
LMOSLCC7179_1015  CDS       T02224                                 

Gene name
glpK-1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lmos00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1025715..1027178
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKEGKLVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIA
DILTKHDLITADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKEICETLKEAGYE
KRIKQLTGLKIDSYFSASKMMWLLENISAVRDAASRNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDTFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGSPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPAEELSAIGAIEIADNNLQNKRTIAKLYQPNITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatagccattgatcaaagcacatctggtacgaaagtattattg
tttaaagaaggcaaacttgtagatcgtttagataaaaagcatcgacagttgtatccaaag
aaaggctgggtggaacataatcccatcgaaatttgtcaaaatgtccgtacattaattgcg
gacatcttgacaaaacatgatttaattacagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacggggaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaaatttgcgaaacgttaaaagaagctggttatgaa
aaaagaattaaacagcttaccggactgaaaattgattcttatttttctgcttctaaaatg
atgtggttattggaaaatatttcagcggtgcgggatgcagcaagtcgtaatcaattggca
tttggcacaatggacgcttggttgttattttcacttacggatgatagtaattattttaca
gaccgaacaaatgctagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaacttttcggagtcaaacgtgcttatttaccagaagtgaaacaatctgct
ggaagttttggaagttatcaggagataccaattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatacatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaatgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaaggaattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggttcgccttattggaatacagatatacgagcagagattctcggtctcaca
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgataggtcaaaatattaagcgcttacaagta
gacggtggattaacaaagcaacatgagttgatgcaatatttagcagatgttttaaaagca
gaagtggcagtcagtcccgcggaagaactttcggcaattggtgctattgaaattgccgac
aataacctacaaaataagagaacgatagcaaaattgtaccaaccaaatatcactcataca
catgctctggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system