KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_1309Help
Entry
LMOSLCC7179_1309  CDS       T02224                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
lmos00010  Glycolysis / Gluconeogenesis
lmos00052  Galactose metabolism
lmos00500  Starch and sucrose metabolism
lmos00520  Amino sugar and nucleotide sugar metabolism
lmos00521  Streptomycin biosynthesis
lmos01100  Metabolic pathways
lmos01110  Biosynthesis of secondary metabolites
lmos01120  Microbial metabolism in diverse environments
lmos01130  Biosynthesis of antibiotics
lmos01200  Carbon metabolism
Module
lmos_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmos_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC7179_1309 (glcK)
   00052 Galactose metabolism
    LMOSLCC7179_1309 (glcK)
   00500 Starch and sucrose metabolism
    LMOSLCC7179_1309 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOSLCC7179_1309 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOSLCC7179_1309 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMOSLCC7179_1309 (glcK)
Enzymes [BR:lmos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMOSLCC7179_1309 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CBY60515
Position
1313101..1314069
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEFTGKSALKDAIDNNETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATRGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaggaaaaatggactattgatacaaatattgaagataaaggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacagacttacaacta
gataatgatattttttacggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacctagggtgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttgaaaatcatattagataatgatgcgaatgttgccgctctt
ggcgaacgctggaaaggcgcaggtgaaggtggcgcgaatgttgttttcgtaacacttgga
acaggcgttggcggtggtatttttgcggaaggtaaaattttacatggcatccgcggggca
gcaggcgaaataggccacgtaacagtagttcctgagaatggttacgattgtacttgtggt
aaaaaaggatgtctagaaactgtcgcatcagcaacaggaattgttcgagtagcgaaagat
ttagcaaaagagtttactggtaaatctgctcttaaagatgcaatagacaacaacgaaacg
attacctccaaattgatttttgaactaggtgcggaagatgatgcattagcgaatgaaaca
attgataaaatttctttctatttggctttagcgcttagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggagtttcagcagcaggagatcaattattgacaccg
gttaaaacttattttgaaacgatggttttcccagctgttaaagaatccactaaattatct
attgcgacaagagggaatgatgcagggataattggagctgcgtggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system