KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_1482Help
Entry
LMOSLCC7179_1482  CDS       T02224                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
lmos03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMOSLCC7179_1482 (recD)
Enzymes [BR:lmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LMOSLCC7179_1482 (recD)
DNA repair and recombination proteins [BR:lmos03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LMOSLCC7179_1482 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_16 AAA_12 AAA_22 NTPase_1 T2SSE UvrD-helicase AAA_18 AAA_17 AAA Zeta_toxin UvrD_C TsaE AAA_28 AAA_29
Motif
Other DBs
NCBI-ProteinID: CBY60688
Position
complement(1486619..1489015)
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFDDTTEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLINYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDVKGIGFQRADELGRKLGLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQSILVAQVEKLVEEQKIITENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLILTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQ
EIFNPNDTGRRKEVQFGDIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMVG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgccttatttgatgatacaacggaagaacttttcatgaag
ggcacgatgttgtctaccattttttacaatgccgaaaacctcttttctgtcgtacgaata
ttggtaaaagaaacaaatgcggattgggacgaaaaagatattatcgtaactggctttttc
ccagcactccacgaacaagaagtctacactttctacggaaaaatgcaggaacatgctaaa
tttggtcaacaattcaaagcagaccggtttcgtaaagaaatgccacaatcacgcgctggt
ttaattaattatctttctggagaactttttaaaggaattggtaaagtaaccgctgaaaat
attgtggatacgattggcgatgatgctattacgaaaattttatccgatccgagtttgtta
aacacggtacctaagttgccatccggtgcagcggaaagtttgcttgcttcccttagagaa
aatcagggattagagcatgtgatggtcggtttaaacgaatatggctttggcccgcaatta
tccatgaaaattttccaggcctataaacaaaatgctattgaagtgttagagaataatcct
tataaattgattgaggacgtaaaagggattggttttcagcgtgccgatgagcttggacgg
aaactcggtcttggcgggaatcatccagaacggcttcgcgcagggattttatttatgtta
gattcggtttgtatgcaacaaggtcacgtatacatggagcaagaggttctgcttggagaa
gtgacatatttgctagaagaaagtgaaggcattcgaattgaccaaagtattttagtagct
caagtagaaaaattggtcgaggaacaaaagattattacggaaaacacacgcgtatacatg
ccatcgctctattattcagagagtggctttgcatatcatgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccacaatccgaatttttactagctctaggagaattagaa
gaaaggattggcgttcattacggagactcacaacgacaggctttagaacaagctttaatg
tctccgatgctcatacttactggtggtcctggaacagggaaaacaacggtcattaaaggg
atagtggagctgtatgcggaactaaatggtgtgagtcttgatccccatgcttacaaagat
ggagcgactttccccgttcttcttgctgctccaactggtcgtgccgctaaacggatgtca
gagtcaactggacttcctgcgatgactattcaccgtctactcggaatgaatggtcaagaa
caaatggatgatgatgcagaaagactgattgatggacgactgttgattgtggatgagatg
tcgatggttgatatttggcttgctaatcaattattccgtgctttaccagcgcacatgcaa
gtggtactcgttggcgaccaagatcagttgccttcagtcggaccgggtcaagtactcaaa
gatattctgcaatctgaacaaattccaactgtagctctttcagatatttatcgccaaaag
gatggttcttccattatcgaaatggcgcattatataaaagaaggcatgttgccagctgat
ttcaccaaaaatagcgccgatcgctccttttttcattgcacggtaaatcaaattggtgat
gtggtcgaacaagtggtaaaaaatgcaaaaaacaaagggtttcgagcaaaagatatccaa
gttttagcaccaatgtatcgtggtcccgcaggcattgatattttaaataaaaaactacaa
gaaatcttcaatccaaatgatacagggcgtcgtaaagaagttcaattcggtgacataaag
tatcgcgtgcatgacaaagtactgcaattgattaatcaaccagagaaaaatgtgtttaac
ggtgatatcggtgaaattgtttctataatctacgccaaagaaaataccgaaaaacaagat
ctgattgtcgttcaatttgaccaaacagaggtttcttactataggcaagaatttaatcaa
ttgacccatgcttattgttgttcgattcataaagctcagggaagtgaatttccgattgtg
attatgccgattgtccgcagttactaccggatgttacgtcgcgatttactctacactgga
gtaacgcggagtaaacaatttctcattctttgcggggaagaagaagcttttcgaatgggg
atagaacgaattgatgaaaataagcgtaatacaacactctctgaacgtttaatgagcgaa
gatgttttattagaacaaatgacgaataaacgaattctcactgctgaaaacattacggaa
attgatccgatgattggaatggaagggattactccagaacagtttatggtaggataa

DBGET integrated database retrieval system