KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_1811Help
Entry
LMOSLCC7179_1811  CDS       T02224                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lmos00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lmos00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1858378..1859289)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATFNEQTFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYAGLEKLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESYLAYGTYLPVDEIVEKVDVMMLLRVQHERHSGTDEFTKESYHEKFGLTEDRAK
KLKEDAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattagag
caggcggcacagtttaaacgcgggaaaaaagcgacttttaatgaacagactttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcggagaaaaag
ttaggcgtggaggttgtttcttttgatgcagcgagctctagcatgacaaaaggagaaacg
ctctacgatacacttctcacgatgcaagccgtaggggtcaatgtcgcagtaattagacac
tcagaagaaaattactatgcgggactcgaaaaattagacattgctattgtgaacggcggt
gatggatgcggtgaacaccctagtcaatcactacttgacttattcacgataaaagaacaa
tttggtacttttcagggtttgaaagtagcgattgctggtgatattcggcacagtcgagtt
gccaattccaatatgaaagtgttaaaaagacttggcgcggaactgtttttctctgggcca
agagaatggtttgacgaaagttacttagcatatggcacatacttaccagttgatgaaatt
gtggaaaaagtggatgtaatgatgcttttgcgtgtacaacatgagcgccatagtggaaca
gatgagtttacgaaagaaagctaccacgaaaaatttggattgacggaagatcgggcaaag
aagttaaaagaagatgcaatcattatgcatccaagccctgtgaaccgagatgtggaaatc
gctgatagtttagtagaaagcgaaaaatcacgcattgttacgcaaatgacgaatggcgtt
tttataagaatggccattttggaagccattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

DBGET integrated database retrieval system