KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_2362Help
Entry
LMOSLCC7179_2362  CDS       T02224                                 

Gene name
est-1
Definition
(RefSeq) carboxylesterase (EC:3.1.1.1)
  KO
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lmos  Listeria monocytogenes SLCC7179
Brite
Enzymes [BR:lmos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LMOSLCC7179_2362 (est-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2423480..2424226)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENNYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTTEQIDAEMVAYKDAPMNTIAKLKDEISGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacaattacacttgctacgcccctcaatacagaggccacggtgtatctcccgacctactg
ctaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggctatactgaaatcgctgtggcgggactttcgctcggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagctcatccccgataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacaactgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aataccatcgctaaattaaaagacgagataagtggcgtcgtggctgaaatagatatgatc
tatgcaccaattatggtcgtccaaggtgaaaaagatgatatggttgatgtcagcggagca
cagctgatttatgatacagtagagtcaacgaagaaagaacttcactggtttaaggaatct
ggtcatgtcatcacattagacaaagaacgaaaagaagtaaaccaagccattttaacattt
ttagatagtttggattggcaagaataa

DBGET integrated database retrieval system