KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_2368Help
Entry
LMOSLCC7179_2368  CDS       T02224                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOSLCC7179_2368 (tpi)
   01230 Biosynthesis of amino acids
    LMOSLCC7179_2368 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC7179_2368 (tpi)
   00051 Fructose and mannose metabolism
    LMOSLCC7179_2368 (tpi)
   00562 Inositol phosphate metabolism
    LMOSLCC7179_2368 (tpi)
Enzymes [BR:lmos01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC7179_2368 (tpi)
Exosome [BR:lmos04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC7179_2368 (tpi)
  Exosomal proteins of bladder cancer cells
   LMOSLCC7179_2368 (tpi)
  Exosomal proteins of melanoma cells
   LMOSLCC7179_2368 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2429834..2430589)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTNLR
VSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactaatcttcgt
gtatctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgacttaggcgtttcttatgttattatcggacactctgaacgtcgtgag
tacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttctacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system