KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_2464Help
Entry
LMOSLCC7179_2464  CDS       T02224                                 

Gene name
murA-2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmos00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lmos00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2528468..2529739)
Genome map
AA seq 423 aa AA seqDB search
MTDRLIIQGGKKLSGTLQVDGAKNSAVALIPAAILAESEVVLEGLPDISDVYTLYDILEE
LGGSVRYDNKTAIIDPTDMLSMPLPSGNVKKLRASYYLMGAMLGRFKKAVIGLPGGCYLG
PRPIDQHIKGFEALGAKVTNEQGAIYLRADELKGARIYLDVVSVGATINIMLAAVRAKGK
TVIENAAKEPEIIDVATLLTNMGAIIKGAGTDTIRITGVDHLHGCHHTIIPDRIEAGTFM
VLAAASGKGIRIENVIPTHLEGIIAKLTEMGVPMDIEEDSIFIGEVENIKKVDIKTYAYP
GFPTDLQQPLTALLTRAEGSSVITDTIYPSRFKHIAELERMGGKFKLEGRSAVISGPAKL
QGSKVTATDLRAGAALVIAGLLAEGRTEIHGVEHIERGYSKIIEKLSAIGADITRSSTAE
TNI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatagattaattattcaaggtggcaaaaaattatcaggcactttgcaagtagac
ggtgcgaaaaatagcgcggttgccttgattccagctgctattttggcggaatctgaagtt
gttttagaaggtttaccggatatttctgatgtatatactctttatgatattttagaagaa
cttggcggcagcgtccgttatgataacaaaacagcaattattgatccaactgatatgctt
tcaatgccacttccatcaggaaatgtgaagaaattgagagcttcttactatttaatgggt
gctatgcttggaaggtttaaaaaagcggtcattggacttccagggggctgttatttgggg
ccgcgtcctatcgatcaacatattaaaggatttgaagcacttggcgcaaaagtaaccaat
gaacagggtgcgatttatttacgggcagatgaattaaaaggcgcgcgcatttacctagat
gtcgtaagtgttggagccacaattaacatcatgttagcagctgttcgtgcaaaaggaaaa
acagtgattgaaaatgcagcaaaagaaccagaaattattgatgtagctactcttttaaca
aatatgggagcaattattaaaggtgctggaacagataccattcgaattactggtgtggat
catcttcatggttgccatcatacgattattcctgatagaatcgaagcgggaacttttatg
gtgctcgcagcggcctcaggaaaaggcatacgaatcgaaaatgttatcccaactcactta
gagggaatcattgcgaaactaacagaaatgggtgttcctatggatattgaggaagattcc
atttttattggtgaagtagagaatataaaaaaagttgatattaaaacatacgcttatcct
ggatttccaactgatttacaacagccactcacggcgcttttaactcgtgcagaaggtagc
agcgtcattacagacacgatttatccgagtcgcttcaagcacattgctgagctggaacga
atgggcggtaagtttaaattagaaggtagatctgctgtgattagtggtccagcaaaatta
caaggttctaaagtaacagcaactgatttaagagcaggtgcagcacttgttattgctgga
cttttggcagaaggaagaacagaaattcatggtgtcgaacatattgaacgtggctacagt
aaaattatcgaaaaactttctgcgattggtgcagatataactcgtagtagtacagcagaa
acaaatatctaa

DBGET integrated database retrieval system