KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_2674Help
Entry
LMOSLCC7179_2674  CDS       T02224                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMOSLCC7179_2674 (recR)
DNA repair and recombination proteins [BR:lmos03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LMOSLCC7179_2674 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2718883..2719479)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLIDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICADTSRDRSVICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKVTRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatagatagttttatgaaattaccaggaatt
ggaccaaaatcggcagctcggctagcattttatgtgttagatatgaaagaagacgatgtg
ctagattttgcaaaagcacttgttgatgcgaagagaaacctaagcttttgttccgtttgt
ggtcacattacagataaggatccatgttatatttgtgctgatacgtcacgcgatcgaagt
gttatttgtgtggtacaagaatccaaagatgtcattgcaatggaaaaaatgcgtgatttt
catggcttataccacgtgcttcatggcacaatttctccaatggacggaattggaccagaa
gatattaatattcctgatttgctgaaacgtttgcaagatgacactattgaagaagttatt
ttagcaacaaatccaaatgttgaaggagaagccactgcgatgtatatttcgcgtttacta
aaaccttcaggcataaaagtaacgagaatagcgcatggccttccagtgggtggagactta
gaatatgcagatgaagtgacgctttcaaaagcaatggaaggacgaagagaagtctaa

DBGET integrated database retrieval system