KEGG   Listeria monocytogenes SLCC7179: LMOSLCC7179_2707Help
Entry
LMOSLCC7179_2707  CDS       T02224                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmos  Listeria monocytogenes SLCC7179
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmos00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMOSLCC7179_2707
Enzymes [BR:lmos01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMOSLCC7179_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2751584..2753266
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQTAYQPAYLKKMLACAENYSNNTRGSIDAISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGKNEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSDTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNLDEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELKTDTYRKTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGSDVFAIKRESEGECIYGIINVTSHDISKKVAFSGTNLLANQP
VTSELELTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggtcaatcaaatagaagtaaaactaagaaaaatttatcaaaccgct
tatcagcccgcatacttgaaaaaaatgctcgcatgcgccgaaaactattctaacaatacg
cgtggttctattgatgctatttccgaaaaaaatgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaaacatccgttacaaacattaaatgagttcctacaagaatatgcg
caagatgttattacagacgtccacttactaccaattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataatgaagcgccgtacaatcaatttttcattgag
aaagacagccaatttgattataaaaatgttactcgcccgcggacttctccgctgttccac
aaatacgaaaacggcaaggaactttggactacttttagcgaagaccagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaaa
caagcgacaagcattcgtcttgatgctattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgagatcatttcgctttggcgtctgctgattgatgag
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcaaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctgacacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggacaagtttcctataaagacaatgcagatggcacgcagtcggtatat
gaacttaatattaactacggtgaagccttgcaaaatctagacgaagacacaaccgaagaa
ctcgtaacaaagaaaattatcgctgctcacagtattttactaacacttcaaggtgtccca
gcgatttactatcattcccttctaggctcaaaaaacgaccttgttggttatgaagaatca
ggtattaatcgtcgaattaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
aaaacagacacttatcgcaaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaaccacaccgctttttcaccatttgcaacccaagaaattttagatttaggatcagat
gtttttgcgataaaacgggaatctgagggagaatgcatttatggaatcatcaacgttact
tctcacgatatcagcaaaaaagtcgctttctctggcactaatttattagccaatcaaccc
gttacgagtgagctcgaattaactgcatatgaagttgtctggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system